Macaca mulatta (rhesus monkey): 708017 Help Entry 708017            CDS       T01028                                  Symbol IL2 Name (RefSeq) interleukin-2 precursor   KO K05429   interleukin 2 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04060   Cytokine-cytokine receptor interaction mcc04061   Viral protein interaction with cytokine and cytokine receptor mcc04151   PI3K-Akt signaling pathway mcc04625   C-type lectin receptor signaling pathway mcc04630   JAK-STAT signaling pathway mcc04658   Th1 and Th2 cell differentiation mcc04659   Th17 cell differentiation mcc04660   T cell receptor signaling pathway mcc04672   Intestinal immune network for IgA production mcc04940   Type I diabetes mellitus mcc05135   Yersinia infection mcc05142   Chagas disease mcc05162   Measles mcc05166   Human T-cell leukemia virus 1 infection mcc05171   Coronavirus disease - COVID-19 mcc05200   Pathways in cancer mcc05320   Autoimmune thyroid disease mcc05321   Inflammatory bowel disease mcc05330   Allograft rejection mcc05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     708017 (IL2)    04151 PI3K-Akt signaling pathway     708017 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     708017 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     708017 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     708017 (IL2)    04660 T cell receptor signaling pathway     708017 (IL2)    04658 Th1 and Th2 cell differentiation     708017 (IL2)    04659 Th17 cell differentiation     708017 (IL2)    04672 Intestinal immune network for IgA production     708017 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     708017 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     708017 (IL2)    05171 Coronavirus disease - COVID-19     708017 (IL2)    05162 Measles     708017 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     708017 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     708017 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     708017 (IL2)    05321 Inflammatory bowel disease     708017 (IL2)    05330 Allograft rejection     708017 (IL2)    05332 Graft-versus-host disease     708017 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     708017 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     708017 (IL2)    00536 Glycosaminoglycan binding proteins [BR:mcc00536]     708017 (IL2) Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Interleukins    708017 (IL2) Glycosaminoglycan binding proteins [BR:mcc00536]  Heparan sulfate / Heparin   Cytokines    708017 (IL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL2 Plasmid_RAQPRD Motif Other DBs NCBI-GeneID:  708017 NCBI-ProteinID:  NP_001040595 Ensembl:  ENSMMUG00000021093 UniProt:  P68291 LinkDB All DBs Position 5:complement(120302362..120307091) Genome browser AA seq 154 aa AA seqDB search MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRDTKDLISNINVIVLELKGS ETTLMCEYADETATIVEFLNRWITFCQSIISTLT NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcacttgtcacaaacagt gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggat ttacagatgattttgaatggaattaataattacaagaatcccaaactcaccaggatgctc acatttaagttttacatgcccaagaaggccacagaattgaaacatcttcagtgtctagaa gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta agagataccaaggacttaatcagcaatatcaacgtaatagttctggaactaaagggatct gaaacaacactgatgtgtgaatatgctgatgagacagcaaccattgtagaatttctgaac agatggattaccttttgtcaaagcatcatctcaacactgacctga

DBGET integrated database retrieval system