Macaca mulatta (rhesus monkey): 708161 Help Entry 708161            CDS       T01028                                  Name (RefSeq) ubiquitin-like isoform X2   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc03010   Ribosome mcc04120   Ubiquitin mediated proteolysis mcc04137   Mitophagy - animal mcc04140   Autophagy - animal mcc05012   Parkinson disease mcc05022   Pathways of neurodegeneration - multiple diseases mcc05167   Kaposi sarcoma-associated herpesvirus infection mcc05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:mcc00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     708161   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     708161  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     708161    04137 Mitophagy - animal     708161  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     708161    05167 Kaposi sarcoma-associated herpesvirus infection     708161   09164 Neurodegenerative disease    05012 Parkinson disease     708161    05022 Pathways of neurodegeneration - multiple diseases     708161  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mcc03011]     708161    04121 Ubiquitin system [BR:mcc04121]     708161 Ribosome [BR:mcc03011]  Ribosomal proteins   Eukaryotes    Large subunit     708161   Archaea     708161 Ubiquitin system [BR:mcc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    708161 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ribosomal_L40e Rad60-SLD Rad60-SLD_2 Ubiquitin_2 TBK1_ULD Dsc3_N Motif Other DBs NCBI-GeneID:  708161 NCBI-ProteinID:  XP_014989324 Ensembl:  ENSMMUG00000023179 LinkDB All DBs Position 3:89447018..89453920 Genome browser AA seq 127 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTTENVKAKIQAKEGIPLDQQRLIFAGKQLEDGRTLSDCN IQKESILHLGLHLQGGIIEPSLCQLAQKYNCDKMICRKCCARLHPCAVNYHKKCSHTSNL RPKKKVK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgcagatctttgtgaagaccctcacaggcaagaccatcaccctcgaggtcgagcccagt gacaccactgagaatgtcaaggccaaaattcaagccaaggagggcatcccacttgaccag cagcgtctgatatttgcgggcaaacagctggaggatggccgcactctctcagactgcaac atccagaaagagtccatcctgcacctggggctgcacctgcaaggtggcattattgagcct tccctctgccagcttgcccagaaatacaactgcgacaagatgatctgccgcaagtgctgt gctcgcctgcacccctgtgctgtcaactaccacaagaagtgcagccacaccagcaacctg cgccccaagaagaaggtcaaataa

DBGET integrated database retrieval system