Macaca mulatta (rhesus monkey): 708847 Help Entry 708847            CDS       T01028                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04613   Neutrophil extracellular trap formation mcc05034   Alcoholism mcc05202   Transcriptional misregulation in cancer mcc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mcc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     708847  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     708847   09163 Immune disease    05322 Systemic lupus erythematosus     708847   09165 Substance dependence    05034 Alcoholism     708847  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcc03036]     708847   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     708847 Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     708847 Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    708847 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF DUF3305 Motif Other DBs NCBI-GeneID:  708847 NCBI-ProteinID:  XP_002806344 LinkDB All DBs Position X:77591465..77592413 Genome browser AA seq 136 aa AA seqDB search MAPTKQTARKSTGGKAPRKQLATKAACKSAPSTGGVKKPHRYRPVTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKCVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcctacgaagcagactgcccgcaaatcgactggtggtaaagcacccaggaagcaa ctggctacaaaagccgcttgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctgttactgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgtctggtgcgagaaattgctcaggactttaaa acagatctgcgcttccagagcgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaatgtgtaacaatt atgccaaaagacatccagctagcacggcgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system