Macaca mulatta (rhesus monkey): 708874 Help Entry 708874            CDS       T01028                                  Name (RefSeq) metallothionein-1F   KO K14739   metallothionein 1/2 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04978   Mineral absorption Brite KEGG Orthology (KO) [BR:mcc00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     708874  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mcc03019]     708874    03029 Mitochondrial biogenesis [BR:mcc03029]     708874 Messenger RNA biogenesis [BR:mcc03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      708874 Mitochondrial biogenesis [BR:mcc03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     708874 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  708874 NCBI-ProteinID:  XP_001097374 UniProt:  A0A5F7ZAH7 LinkDB All DBs Position 20:complement(43850293..43852043) Genome browser AA seq 61 aa AA seqDB search MDPNCSCAAGVSCACAGSCKCKECKCTSCKKSCCSCCPLGCAKCAQGCICKGASEKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgttcctgcgccgctggtgtctcctgcgcctgcgctggctcctgtaag tgcaaagagtgcaaatgcacctcctgcaagaagagctgctgctcctgctgccccctgggc tgtgccaagtgtgcccagggctgtatctgcaaaggggcgtcagagaagtgcagctgctgc gcctga

DBGET integrated database retrieval system