Macaca mulatta (rhesus monkey): 709089 Help Entry 709089            CDS       T01028                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc01521   EGFR tyrosine kinase inhibitor resistance mcc01522   Endocrine resistance mcc04010   MAPK signaling pathway mcc04012   ErbB signaling pathway mcc04014   Ras signaling pathway mcc04015   Rap1 signaling pathway mcc04062   Chemokine signaling pathway mcc04068   FoxO signaling pathway mcc04071   Sphingolipid signaling pathway mcc04072   Phospholipase D signaling pathway mcc04137   Mitophagy - animal mcc04140   Autophagy - animal mcc04150   mTOR signaling pathway mcc04151   PI3K-Akt signaling pathway mcc04210   Apoptosis mcc04211   Longevity regulating pathway mcc04213   Longevity regulating pathway - multiple species mcc04218   Cellular senescence mcc04360   Axon guidance mcc04370   VEGF signaling pathway mcc04371   Apelin signaling pathway mcc04540   Gap junction mcc04550   Signaling pathways regulating pluripotency of stem cells mcc04625   C-type lectin receptor signaling pathway mcc04650   Natural killer cell mediated cytotoxicity mcc04660   T cell receptor signaling pathway mcc04662   B cell receptor signaling pathway mcc04664   Fc epsilon RI signaling pathway mcc04714   Thermogenesis mcc04720   Long-term potentiation mcc04722   Neurotrophin signaling pathway mcc04725   Cholinergic synapse mcc04726   Serotonergic synapse mcc04730   Long-term depression mcc04810   Regulation of actin cytoskeleton mcc04910   Insulin signaling pathway mcc04912   GnRH signaling pathway mcc04915   Estrogen signaling pathway mcc04916   Melanogenesis mcc04917   Prolactin signaling pathway mcc04919   Thyroid hormone signaling pathway mcc04921   Oxytocin signaling pathway mcc04926   Relaxin signaling pathway mcc04929   GnRH secretion mcc04933   AGE-RAGE signaling pathway in diabetic complications mcc04935   Growth hormone synthesis, secretion and action mcc05010   Alzheimer disease mcc05022   Pathways of neurodegeneration - multiple diseases mcc05034   Alcoholism mcc05160   Hepatitis C mcc05161   Hepatitis B mcc05163   Human cytomegalovirus infection mcc05165   Human papillomavirus infection mcc05166   Human T-cell leukemia virus 1 infection mcc05167   Kaposi sarcoma-associated herpesvirus infection mcc05170   Human immunodeficiency virus 1 infection mcc05200   Pathways in cancer mcc05203   Viral carcinogenesis mcc05205   Proteoglycans in cancer mcc05206   MicroRNAs in cancer mcc05207   Chemical carcinogenesis - receptor activation mcc05208   Chemical carcinogenesis - reactive oxygen species mcc05210   Colorectal cancer mcc05211   Renal cell carcinoma mcc05213   Endometrial cancer mcc05214   Glioma mcc05215   Prostate cancer mcc05216   Thyroid cancer mcc05218   Melanoma mcc05219   Bladder cancer mcc05220   Chronic myeloid leukemia mcc05221   Acute myeloid leukemia mcc05223   Non-small cell lung cancer mcc05224   Breast cancer mcc05225   Hepatocellular carcinoma mcc05226   Gastric cancer mcc05230   Central carbon metabolism in cancer mcc05231   Choline metabolism in cancer mcc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mcc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     709089 (NRAS)    04012 ErbB signaling pathway     709089 (NRAS)    04014 Ras signaling pathway     709089 (NRAS)    04015 Rap1 signaling pathway     709089 (NRAS)    04370 VEGF signaling pathway     709089 (NRAS)    04371 Apelin signaling pathway     709089 (NRAS)    04068 FoxO signaling pathway     709089 (NRAS)    04072 Phospholipase D signaling pathway     709089 (NRAS)    04071 Sphingolipid signaling pathway     709089 (NRAS)    04151 PI3K-Akt signaling pathway     709089 (NRAS)    04150 mTOR signaling pathway     709089 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     709089 (NRAS)    04137 Mitophagy - animal     709089 (NRAS)   09143 Cell growth and death    04210 Apoptosis     709089 (NRAS)    04218 Cellular senescence     709089 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     709089 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     709089 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     709089 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     709089 (NRAS)    04650 Natural killer cell mediated cytotoxicity     709089 (NRAS)    04660 T cell receptor signaling pathway     709089 (NRAS)    04662 B cell receptor signaling pathway     709089 (NRAS)    04664 Fc epsilon RI signaling pathway     709089 (NRAS)    04062 Chemokine signaling pathway     709089 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     709089 (NRAS)    04929 GnRH secretion     709089 (NRAS)    04912 GnRH signaling pathway     709089 (NRAS)    04915 Estrogen signaling pathway     709089 (NRAS)    04917 Prolactin signaling pathway     709089 (NRAS)    04921 Oxytocin signaling pathway     709089 (NRAS)    04926 Relaxin signaling pathway     709089 (NRAS)    04935 Growth hormone synthesis, secretion and action     709089 (NRAS)    04919 Thyroid hormone signaling pathway     709089 (NRAS)    04916 Melanogenesis     709089 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     709089 (NRAS)    04726 Serotonergic synapse     709089 (NRAS)    04720 Long-term potentiation     709089 (NRAS)    04730 Long-term depression     709089 (NRAS)    04722 Neurotrophin signaling pathway     709089 (NRAS)   09158 Development and regeneration    04360 Axon guidance     709089 (NRAS)   09149 Aging    04211 Longevity regulating pathway     709089 (NRAS)    04213 Longevity regulating pathway - multiple species     709089 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     709089 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     709089 (NRAS)    05206 MicroRNAs in cancer     709089 (NRAS)    05205 Proteoglycans in cancer     709089 (NRAS)    05207 Chemical carcinogenesis - receptor activation     709089 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     709089 (NRAS)    05203 Viral carcinogenesis     709089 (NRAS)    05230 Central carbon metabolism in cancer     709089 (NRAS)    05231 Choline metabolism in cancer     709089 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     709089 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     709089 (NRAS)    05225 Hepatocellular carcinoma     709089 (NRAS)    05226 Gastric cancer     709089 (NRAS)    05214 Glioma     709089 (NRAS)    05216 Thyroid cancer     709089 (NRAS)    05221 Acute myeloid leukemia     709089 (NRAS)    05220 Chronic myeloid leukemia     709089 (NRAS)    05218 Melanoma     709089 (NRAS)    05211 Renal cell carcinoma     709089 (NRAS)    05219 Bladder cancer     709089 (NRAS)    05215 Prostate cancer     709089 (NRAS)    05213 Endometrial cancer     709089 (NRAS)    05224 Breast cancer     709089 (NRAS)    05223 Non-small cell lung cancer     709089 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     709089 (NRAS)    05170 Human immunodeficiency virus 1 infection     709089 (NRAS)    05161 Hepatitis B     709089 (NRAS)    05160 Hepatitis C     709089 (NRAS)    05163 Human cytomegalovirus infection     709089 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     709089 (NRAS)    05165 Human papillomavirus infection     709089 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     709089 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     709089 (NRAS)   09165 Substance dependence    05034 Alcoholism     709089 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     709089 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     709089 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     709089 (NRAS)    01522 Endocrine resistance     709089 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcc04131]     709089 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     709089 (NRAS)    04031 GTP-binding proteins [BR:mcc04031]     709089 (NRAS) Membrane trafficking [BR:mcc04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     709089 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     709089 (NRAS) Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    709089 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    709089 (NRAS)   Exosomal proteins of breast cancer cells    709089 (NRAS)   Exosomal proteins of colorectal cancer cells    709089 (NRAS) GTP-binding proteins [BR:mcc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     709089 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin ParA Ldh_1_N Motif Other DBs NCBI-GeneID:  709089 NCBI-ProteinID:  XP_015004311 Ensembl:  ENSMMUG00000049105 UniProt:  A0A1D5QQS3 A0A8J8YGS2 LinkDB All DBs Position 1:109498669..109511242 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac agaaaacaggtggttatagatggtgaaacctgtttgttggacatactggatacagctgga caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaataatagcaagtcatttgcggatattaacctctacagggagcagatt aagcgagtaaaagactcagatgatgtacctatggtgctagtgggaaacaagtgtgatttg ccaacaaggacagttgatacaaaacaagcccacgaactggccaagagttacgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcagggt tgtatgggattaccatgtgtggtgatgtaa

DBGET integrated database retrieval system