Macaca mulatta (rhesus monkey): 709273 Help Entry 709273            CDS       T01028                                  Name (RefSeq) metallothionein-1A isoform X1   KO K14739   metallothionein 1/2 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04978   Mineral absorption Brite KEGG Orthology (KO) [BR:mcc00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     709273  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mcc03019]     709273    03029 Mitochondrial biogenesis [BR:mcc03029]     709273 Messenger RNA biogenesis [BR:mcc03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      709273 Mitochondrial biogenesis [BR:mcc03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     709273 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  709273 NCBI-ProteinID:  XP_001097779 Ensembl:  ENSMMUG00000029122 LinkDB All DBs Position 20:complement(43883750..43888274) Genome browser AA seq 61 aa AA seqDB search MDPNCSCTTGGSCTCTESCKCKECKCTFCKKSCCSCCPVSCAKCAQGCICKGALEKCSCC D NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgcaccactggtggctcctgcacctgcactgagtcctgcaag tgcaaagagtgcaaatgcacattctgcaagaagagctgctgctcctgctgccccgtgagc tgtgccaagtgtgcccagggctgcatctgtaaaggggcattagagaagtgtagctgctgc gactga

DBGET integrated database retrieval system