Macaca mulatta (rhesus monkey): 709296 Help Entry 709296            CDS       T01028                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04613   Neutrophil extracellular trap formation mcc05034   Alcoholism mcc05202   Transcriptional misregulation in cancer mcc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mcc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     709296  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     709296   09163 Immune disease    05322 Systemic lupus erythematosus     709296   09165 Substance dependence    05034 Alcoholism     709296  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcc03036]     709296   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     709296 Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     709296 Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    709296 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  709296 NCBI-ProteinID:  XP_001096527 LinkDB All DBs Position 10:28936320..28937190 Genome browser AA seq 136 aa AA seqDB search MARTKQTACKSTSGKAPRKQPATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQPLVREIAQDFKTDLRFQSAAIGALQEASEPYLVGLFEDTNLCAIHAKRVTI MPKDIQLACRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcctgcaaatcgaccagtggtaaagcacccaggaagcaa ccggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaaccgcat cgttacaggcctggtactgtggcgctccgtgaaattagacgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagcctctggtgcgagaaattgctcaggactttaaa acagatctgcgcttccagagcgcagctatcggtgctttgcaggaggcaagtgagccctat ctggttggcctttttgaagacactaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcatgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system