Macaca mulatta (rhesus monkey): 709308 Help Entry 709308            CDS       T01028                                  Symbol RAB5C Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04014   Ras signaling pathway mcc04137   Mitophagy - animal mcc04144   Endocytosis mcc04145   Phagosome mcc04148   Efferocytosis mcc04962   Vasopressin-regulated water reabsorption mcc05132   Salmonella infection mcc05146   Amoebiasis mcc05152   Tuberculosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     709308 (RAB5C)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     709308 (RAB5C)    04145 Phagosome     709308 (RAB5C)    04137 Mitophagy - animal     709308 (RAB5C)    04148 Efferocytosis     709308 (RAB5C)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     709308 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     709308 (RAB5C)    05152 Tuberculosis     709308 (RAB5C)   09174 Infectious disease: parasitic    05146 Amoebiasis     709308 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcc04131]     709308 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     709308 (RAB5C)    04031 GTP-binding proteins [BR:mcc04031]     709308 (RAB5C) Membrane trafficking [BR:mcc04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     709308 (RAB5C)  Endosome - Lysosome transport     709308 (RAB5C) Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    709308 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    709308 (RAB5C)   Exosomal proteins of colorectal cancer cells    709308 (RAB5C)   Exosomal proteins of bladder cancer cells    709308 (RAB5C) GTP-binding proteins [BR:mcc04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     709308 (RAB5C) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  709308 NCBI-ProteinID:  NP_001253100 Ensembl:  ENSMMUG00000014756 UniProt:  F7G108 A0A8J8YIS9 LinkDB All DBs Position 16:complement(53247329..53278271) Genome browser AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcggggaggcgcagcacgacccaatggaccagccgctgggaacaagatctgt cagtttaaactggttctgctgggggagtctgcggtgggcaaatccagcctcgtcctccgc tttgtcaagggacagtttcacgagtaccaggagagcacaatcggagcggccttcctcaca cagactgtctgcctggatgacacaacagtcaagtttgagatctgggacacagctggacag gagcggtatcacagcctggcccccatgtactatcggggggctcaggctgccatcgtggtc tatgacatcaccaacacagatacatttgcacgggccaagaactgggtgaaggagctacag aggcaggccagccccaacatcgtcattgcactcgcgggtaacaaggcagacctggccagc aagagagccgtggaattccaggaagcacaagcctatgcagatgacaacagtttgctgttc atggagacatcagcaaagactgcaatgaacgtgaacgaaatcttcatggcaatagctaag aagcttcccaagaacgagccccagaatgcaactggtgctccaggccgaaaccgaggtgtg gacctccaggagaacaacccagccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system