Macaca mulatta (rhesus monkey): 709559 Help Entry 709559            CDS       T01028                                  Symbol IFNA13 Name (RefSeq) interferon alpha-1/13 precursor   KO K05414   interferon alpha Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04060   Cytokine-cytokine receptor interaction mcc04151   PI3K-Akt signaling pathway mcc04217   Necroptosis mcc04620   Toll-like receptor signaling pathway mcc04621   NOD-like receptor signaling pathway mcc04622   RIG-I-like receptor signaling pathway mcc04623   Cytosolic DNA-sensing pathway mcc04630   JAK-STAT signaling pathway mcc04650   Natural killer cell mediated cytotoxicity mcc04936   Alcoholic liver disease mcc05152   Tuberculosis mcc05160   Hepatitis C mcc05161   Hepatitis B mcc05162   Measles mcc05163   Human cytomegalovirus infection mcc05164   Influenza A mcc05165   Human papillomavirus infection mcc05167   Kaposi sarcoma-associated herpesvirus infection mcc05168   Herpes simplex virus 1 infection mcc05169   Epstein-Barr virus infection mcc05170   Human immunodeficiency virus 1 infection mcc05171   Coronavirus disease - COVID-19 mcc05200   Pathways in cancer mcc05320   Autoimmune thyroid disease mcc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     709559 (IFNA13)    04151 PI3K-Akt signaling pathway     709559 (IFNA13)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     709559 (IFNA13)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     709559 (IFNA13)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     709559 (IFNA13)    04621 NOD-like receptor signaling pathway     709559 (IFNA13)    04622 RIG-I-like receptor signaling pathway     709559 (IFNA13)    04623 Cytosolic DNA-sensing pathway     709559 (IFNA13)    04650 Natural killer cell mediated cytotoxicity     709559 (IFNA13)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     709559 (IFNA13)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     709559 (IFNA13)    05161 Hepatitis B     709559 (IFNA13)    05160 Hepatitis C     709559 (IFNA13)    05171 Coronavirus disease - COVID-19     709559 (IFNA13)    05164 Influenza A     709559 (IFNA13)    05162 Measles     709559 (IFNA13)    05168 Herpes simplex virus 1 infection     709559 (IFNA13)    05163 Human cytomegalovirus infection     709559 (IFNA13)    05167 Kaposi sarcoma-associated herpesvirus infection     709559 (IFNA13)    05169 Epstein-Barr virus infection     709559 (IFNA13)    05165 Human papillomavirus infection     709559 (IFNA13)   09171 Infectious disease: bacterial    05152 Tuberculosis     709559 (IFNA13)   09163 Immune disease    05320 Autoimmune thyroid disease     709559 (IFNA13)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     709559 (IFNA13)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     709559 (IFNA13)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     709559 (IFNA13) Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Interferons    709559 (IFNA13) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon iSTAND Motif Other DBs NCBI-GeneID:  709559 NCBI-ProteinID:  NP_001181296 Ensembl:  ENSMMUG00000048619 UniProt:  A0A5F8AJA6 LinkDB All DBs Position 15:complement(62229586..62230457) Genome browser AA seq 190 aa AA seqDB search MMALPFALLMALVVLSSKSSCSLGCDLPETHSLDNRKTMMLLAQMSRISPSSCLMDRHDF GFPQQEFDGNQFQKAPAISVLHELIQQTFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDL EACVMQQERVGETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSLST NLQERLRRKE NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atgatggccttgccctttgctttactgatggccctggtggtgctcagcagcaagtcaagt tgctctctgggctgtgatctgcctgagacccacagcctggataacaggaagaccatgatg ctcctggcacagatgagcagaatctctccttcctcctgtctgatggacagacatgacttt ggatttccccagcaggagtttgatggcaaccagttccagaaggctccagccatctctgtc ctccatgagctgatccagcagaccttcaacctctttaccacaaaagactcatctgctgct tgggatgaggacctcctagacaaattctgcactgaactctaccagcagctgaatgacttg gaagcctgtgtcatgcagcaggagagggtgggagaaactcccctgatgaatgcggactcc accttggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatac agcccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttatcaaca aacttgcaagaaagattaaggaggaaggaataa

DBGET integrated database retrieval system