Macaca mulatta (rhesus monkey): 709619 Help Entry 709619            CDS       T01028                                  Name (RefSeq) metallothionein 1-like   KO K14739   metallothionein 1/2 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04978   Mineral absorption Brite KEGG Orthology (KO) [BR:mcc00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     709619  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mcc03019]     709619    03029 Mitochondrial biogenesis [BR:mcc03029]     709619 Messenger RNA biogenesis [BR:mcc03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      709619 Mitochondrial biogenesis [BR:mcc03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     709619 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  709619 NCBI-ProteinID:  NP_001288240 UniProt:  F6PZW8 LinkDB All DBs Position 20:complement(43908419..43909732) Genome browser AA seq 61 aa AA seqDB search MDPNCSCASGVSCTCPGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGVLDKCCCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgcgcctctggtgtctcctgcacctgccctggctcctgcaag tgcaaagagtgcaaatgcacctcctgcaagaagagctgctgctcctgctgccctgtgggc tgtgccaagtgtgcccagggctgcatctgcaaaggggtgttggacaagtgctgctgctgc gcctga

DBGET integrated database retrieval system