Macaca mulatta (rhesus monkey): 710753 Help Entry 710753            CDS       T01028                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04015   Rap1 signaling pathway mcc04810   Regulation of actin cytoskeleton mcc05014   Amyotrophic lateral sclerosis mcc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     710753 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     710753 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     710753 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     710753 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcc04131]     710753 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mcc04812]     710753 (PFN1)    04147 Exosome [BR:mcc04147]     710753 (PFN1) Membrane trafficking [BR:mcc04131]  Others   Actin-binding proteins    Others     710753 (PFN1) Cytoskeleton proteins [BR:mcc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      710753 (PFN1) Exosome [BR:mcc04147]  Exosomal proteins   Proteins found in most exosomes    710753 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  710753 NCBI-ProteinID:  XP_014973845 Ensembl:  ENSMMUG00000002772 UniProt:  F7H2A5 LinkDB All DBs Position 16:complement(4793085..4796495) Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFY VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVH GGLINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggttacaaggactcgccctccgtctgggccgccgtccccgggaaaaccttc gtcaacatcacgccagctgaggtgggtgtcctggttggcaaagaccggtcaagtttttac gtcaatgggctgacacttgggggccagaaatgttcggtgatccgggactcactgctgcag gatggggagtttagcatggatcttcgtaccaagagcaccggtggggcccccaccttcaat gtcactgtcaccaagactgacaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtttgatcaacaagaaatgttatgaaatggcctcccaccttcggcgctcccagtac tga

DBGET integrated database retrieval system