Macaca mulatta (rhesus monkey): 710848 Help Entry 710848            CDS       T01028                                  Name (RefSeq) interferon alpha-17   KO K05414   interferon alpha Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04060   Cytokine-cytokine receptor interaction mcc04151   PI3K-Akt signaling pathway mcc04217   Necroptosis mcc04620   Toll-like receptor signaling pathway mcc04621   NOD-like receptor signaling pathway mcc04622   RIG-I-like receptor signaling pathway mcc04623   Cytosolic DNA-sensing pathway mcc04630   JAK-STAT signaling pathway mcc04650   Natural killer cell mediated cytotoxicity mcc04936   Alcoholic liver disease mcc05152   Tuberculosis mcc05160   Hepatitis C mcc05161   Hepatitis B mcc05162   Measles mcc05163   Human cytomegalovirus infection mcc05164   Influenza A mcc05165   Human papillomavirus infection mcc05167   Kaposi sarcoma-associated herpesvirus infection mcc05168   Herpes simplex virus 1 infection mcc05169   Epstein-Barr virus infection mcc05170   Human immunodeficiency virus 1 infection mcc05171   Coronavirus disease - COVID-19 mcc05200   Pathways in cancer mcc05320   Autoimmune thyroid disease mcc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     710848    04151 PI3K-Akt signaling pathway     710848   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     710848  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     710848  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     710848    04621 NOD-like receptor signaling pathway     710848    04622 RIG-I-like receptor signaling pathway     710848    04623 Cytosolic DNA-sensing pathway     710848    04650 Natural killer cell mediated cytotoxicity     710848  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     710848   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     710848    05161 Hepatitis B     710848    05160 Hepatitis C     710848    05171 Coronavirus disease - COVID-19     710848    05164 Influenza A     710848    05162 Measles     710848    05168 Herpes simplex virus 1 infection     710848    05163 Human cytomegalovirus infection     710848    05167 Kaposi sarcoma-associated herpesvirus infection     710848    05169 Epstein-Barr virus infection     710848    05165 Human papillomavirus infection     710848   09171 Infectious disease: bacterial    05152 Tuberculosis     710848   09163 Immune disease    05320 Autoimmune thyroid disease     710848   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     710848   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     710848  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     710848 Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Interferons    710848 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon iSTAND Mkg_C CoV_NSP2_N Motif Other DBs NCBI-GeneID:  710848 NCBI-ProteinID:  XP_001107817 LinkDB All DBs Position 15:62449828..62450758 Genome browser AA seq 189 aa AA seqDB search MALSFSLLMAVVVLSYKSICSLGCDLPQTHSLGHRRALILLAQMGRISPFSCLKDRHDFG FPQEEFDGNQFQKAQAMSVLHEMIQQTFNLFSTKDSSAAWEQNLLEKFSAELYQQLNDLK ACVIAEPGMEDTPLMNEDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTN LQKRLRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccctgtccttttctttactgatggccgtggtggtgctcagctacaaatccatctgc tctctgggctgtgatcttcctcagacccacagcctgggtcataggagggccttgatactc ctggcacaaatgggaaggatctctccgttctcctgtctgaaggacagacatgactttgga ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatgtctgtcctc catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg gaacagaacctcctagaaaaattttccgctgagctttaccagcaactgaatgacctgaaa gcctgtgtgatagcagagcctgggatggaagacactcccttgatgaatgaggactccatc ctggctgtgaagaaatacttccaaagaatcactctctatctgacggagaagaaatacagc ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac ttgcaaaaaagattaaggaggaaggattga

DBGET integrated database retrieval system