Macaca mulatta (rhesus monkey): 711015 Help Entry 711015            CDS       T01028                                  Symbol UBL5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism mcc  Macaca mulatta (rhesus monkey) Brite KEGG Orthology (KO) [BR:mcc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:mcc03041]     711015 (UBL5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     711015 (UBL5) Spliceosome [BR:mcc03041]  Complex B   Other components    Complex B specific factors     711015 (UBL5) Cytokines and neuropeptides [BR:mcc04052]  Neuropeptides   Unclassified    711015 (UBL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  711015 NCBI-ProteinID:  NP_001247979 UniProt:  H9YVU4 A0A8J8XAA9 LinkDB All DBs Position 19:9570418..9573020 Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggttgtttgcaacgaccgtctggggaagaaggtccgcgttaaatgcaacacg gatgatactatcggggaccttaagaagctgattgcagcccaaactggcacccgttggaac aagattgtcctgaagaagtggtacacgatttttaaggaccacgtgtctctgggggactat gaaatccacgatgggatgaacctggagctttattaccaatag

DBGET integrated database retrieval system