Macaca mulatta (rhesus monkey): 711088 Help Entry 711088            CDS       T01028                                  Name (RefSeq) interferon alpha-17-like   KO K05414   interferon alpha Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04060   Cytokine-cytokine receptor interaction mcc04151   PI3K-Akt signaling pathway mcc04217   Necroptosis mcc04620   Toll-like receptor signaling pathway mcc04621   NOD-like receptor signaling pathway mcc04622   RIG-I-like receptor signaling pathway mcc04623   Cytosolic DNA-sensing pathway mcc04630   JAK-STAT signaling pathway mcc04650   Natural killer cell mediated cytotoxicity mcc04936   Alcoholic liver disease mcc05152   Tuberculosis mcc05160   Hepatitis C mcc05161   Hepatitis B mcc05162   Measles mcc05163   Human cytomegalovirus infection mcc05164   Influenza A mcc05165   Human papillomavirus infection mcc05167   Kaposi sarcoma-associated herpesvirus infection mcc05168   Herpes simplex virus 1 infection mcc05169   Epstein-Barr virus infection mcc05170   Human immunodeficiency virus 1 infection mcc05171   Coronavirus disease - COVID-19 mcc05200   Pathways in cancer mcc05320   Autoimmune thyroid disease mcc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     711088    04151 PI3K-Akt signaling pathway     711088   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     711088  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     711088  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     711088    04621 NOD-like receptor signaling pathway     711088    04622 RIG-I-like receptor signaling pathway     711088    04623 Cytosolic DNA-sensing pathway     711088    04650 Natural killer cell mediated cytotoxicity     711088  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     711088   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     711088    05161 Hepatitis B     711088    05160 Hepatitis C     711088    05171 Coronavirus disease - COVID-19     711088    05164 Influenza A     711088    05162 Measles     711088    05168 Herpes simplex virus 1 infection     711088    05163 Human cytomegalovirus infection     711088    05167 Kaposi sarcoma-associated herpesvirus infection     711088    05169 Epstein-Barr virus infection     711088    05165 Human papillomavirus infection     711088   09171 Infectious disease: bacterial    05152 Tuberculosis     711088   09163 Immune disease    05320 Autoimmune thyroid disease     711088   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     711088   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     711088  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     711088 Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Interferons    711088 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon iSTAND Mkg_C Motif Other DBs NCBI-GeneID:  711088 NCBI-ProteinID:  XP_028690319 LinkDB All DBs Position 15:62470125..62470994 Genome browser AA seq 189 aa AA seqDB search MALSFSLLMAVVVLSYKSICSLGCDLPRTHSLGHRRALILLAQMGRISPFSCLKDRHDFG FPQEEFDGNQFQKAQAVSVLHEMIQQTFNLFSTKDSSAAWEQNLLEKFSAELYQQLNDLK ACVIAEPGMEETLLMNEDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTN LQKRLRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccctgtccttttctttactgatggccgtggtggtgctcagctacaaatccatctgc tctctgggctgtgatctgcctcggacccacagcctgggtcataggagggccttgatactc ctggcacaaatgggaagaatctctcctttctcctgtctgaaggacagacatgactttgga ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccgtctctgtcctc catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg gaacagaacctcctagaaaaattttccgctgagctttaccagcaactgaatgacctgaaa gcctgtgtgatagcagagcctgggatggaagagactctcttgatgaatgaggactccatc ctggctgtgaagaaatacttccaaagaatcactctctatctgacggagaagaaatacagc ccatgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac ttgcaaaaaagattaaggaggaaggattga

DBGET integrated database retrieval system