Macaca mulatta (rhesus monkey): 711252 Help Entry 711252            CDS       T01028                                  Symbol IFNA21 Name (RefSeq) interferon alpha-21   KO K05414   interferon alpha Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04060   Cytokine-cytokine receptor interaction mcc04151   PI3K-Akt signaling pathway mcc04217   Necroptosis mcc04620   Toll-like receptor signaling pathway mcc04621   NOD-like receptor signaling pathway mcc04622   RIG-I-like receptor signaling pathway mcc04623   Cytosolic DNA-sensing pathway mcc04630   JAK-STAT signaling pathway mcc04650   Natural killer cell mediated cytotoxicity mcc04936   Alcoholic liver disease mcc05152   Tuberculosis mcc05160   Hepatitis C mcc05161   Hepatitis B mcc05162   Measles mcc05163   Human cytomegalovirus infection mcc05164   Influenza A mcc05165   Human papillomavirus infection mcc05167   Kaposi sarcoma-associated herpesvirus infection mcc05168   Herpes simplex virus 1 infection mcc05169   Epstein-Barr virus infection mcc05170   Human immunodeficiency virus 1 infection mcc05171   Coronavirus disease - COVID-19 mcc05200   Pathways in cancer mcc05320   Autoimmune thyroid disease mcc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     711252 (IFNA21)    04151 PI3K-Akt signaling pathway     711252 (IFNA21)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     711252 (IFNA21)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     711252 (IFNA21)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     711252 (IFNA21)    04621 NOD-like receptor signaling pathway     711252 (IFNA21)    04622 RIG-I-like receptor signaling pathway     711252 (IFNA21)    04623 Cytosolic DNA-sensing pathway     711252 (IFNA21)    04650 Natural killer cell mediated cytotoxicity     711252 (IFNA21)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     711252 (IFNA21)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     711252 (IFNA21)    05161 Hepatitis B     711252 (IFNA21)    05160 Hepatitis C     711252 (IFNA21)    05171 Coronavirus disease - COVID-19     711252 (IFNA21)    05164 Influenza A     711252 (IFNA21)    05162 Measles     711252 (IFNA21)    05168 Herpes simplex virus 1 infection     711252 (IFNA21)    05163 Human cytomegalovirus infection     711252 (IFNA21)    05167 Kaposi sarcoma-associated herpesvirus infection     711252 (IFNA21)    05169 Epstein-Barr virus infection     711252 (IFNA21)    05165 Human papillomavirus infection     711252 (IFNA21)   09171 Infectious disease: bacterial    05152 Tuberculosis     711252 (IFNA21)   09163 Immune disease    05320 Autoimmune thyroid disease     711252 (IFNA21)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     711252 (IFNA21)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     711252 (IFNA21)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     711252 (IFNA21) Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Interferons    711252 (IFNA21) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  711252 NCBI-ProteinID:  XP_001108051 UniProt:  A0A7R8GUY4 LinkDB All DBs Position 15:62485063..62485685 Genome browser AA seq 188 aa AA seqDB search MALSFSLLVAVVVLSYKSICSLGCDLPRTHSLGHRRALILLAQMGRISPFSCLKDRHDFG FPQEEFDGNQFHKAQAISVLHEMIQQTFNLFSTKDSSAAWEHSLLEKFSTGLYQQLNDLE ACVIQEVGVEETPLTNVDCILAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSFSFSTT LQERLRRK NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atggccctgtccttttctttactggtggccgtggtggtgctcagctacaaatccatctgc tctctgggctgtgatctgcctcggacccacagcctgggtcataggagggccttgatactc ctggcacaaatgggaagaatctctcctttctcctgtctgaaggacagacatgactttgga ttcccccaggaggagtttgatggcaaccagttccacaaggctcaagccatctctgtcctc catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg gaacacagcctcctagaaaaattttccactggactttaccagcaactgaatgacctggaa gcctgtgtgatacaggaggttggagtggaagagactccactgacgaatgtggactgcatc ctggctgtgaggaaatacttccaaagaatcaccctctatctgatggagaagaaatacagc ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttttcaacaacc ttacaagaaagattaaggaggaagtaa

DBGET integrated database retrieval system