Macaca mulatta (rhesus monkey): 711309 Help Entry 711309            CDS       T01028                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc00190   Oxidative phosphorylation mcc01100   Metabolic pathways mcc01524   Platinum drug resistance mcc04115   p53 signaling pathway mcc04210   Apoptosis mcc04215   Apoptosis - multiple species mcc04932   Non-alcoholic fatty liver disease mcc05010   Alzheimer disease mcc05012   Parkinson disease mcc05014   Amyotrophic lateral sclerosis mcc05016   Huntington disease mcc05017   Spinocerebellar ataxia mcc05020   Prion disease mcc05022   Pathways of neurodegeneration - multiple diseases mcc05132   Salmonella infection mcc05134   Legionellosis mcc05145   Toxoplasmosis mcc05152   Tuberculosis mcc05160   Hepatitis C mcc05161   Hepatitis B mcc05162   Measles mcc05163   Human cytomegalovirus infection mcc05164   Influenza A mcc05167   Kaposi sarcoma-associated herpesvirus infection mcc05168   Herpes simplex virus 1 infection mcc05169   Epstein-Barr virus infection mcc05170   Human immunodeficiency virus 1 infection mcc05200   Pathways in cancer mcc05210   Colorectal cancer mcc05222   Small cell lung cancer mcc05416   Viral myocarditis mcc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     711309  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     711309    04215 Apoptosis - multiple species     711309    04115 p53 signaling pathway     711309  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     711309   09162 Cancer: specific types    05210 Colorectal cancer     711309    05222 Small cell lung cancer     711309   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     711309    05161 Hepatitis B     711309    05160 Hepatitis C     711309    05164 Influenza A     711309    05162 Measles     711309    05168 Herpes simplex virus 1 infection     711309    05163 Human cytomegalovirus infection     711309    05167 Kaposi sarcoma-associated herpesvirus infection     711309    05169 Epstein-Barr virus infection     711309   09171 Infectious disease: bacterial    05132 Salmonella infection     711309    05134 Legionellosis     711309    05152 Tuberculosis     711309   09174 Infectious disease: parasitic    05145 Toxoplasmosis     711309   09164 Neurodegenerative disease    05010 Alzheimer disease     711309    05012 Parkinson disease     711309    05014 Amyotrophic lateral sclerosis     711309    05016 Huntington disease     711309    05017 Spinocerebellar ataxia     711309    05020 Prion disease     711309    05022 Pathways of neurodegeneration - multiple diseases     711309   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     711309    05416 Viral myocarditis     711309   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     711309   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     711309 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 zf-PHD-like Motif Other DBs NCBI-GeneID:  711309 NCBI-ProteinID:  XP_014994772 Ensembl:  ENSMMUG00000040728 LinkDB All DBs Position 1:complement(174213729..174215058) Genome browser AA seq 153 aa AA seqDB search MFLGVLISPASLAISSQSPLRVPLTREWGCPASERESSLRQRLKRELNIGDVEKGKKIFI MKCSQCHTVEKEGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGITWGEDTLMEYLENP KKYIPGTKMIFVGTKKNEERADLIAYLKKATNE NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgttcctaggtgtgctgatctccccagcctcactggctatctcttcgcagtctccttta agagttccacttacgagagagtggggatgtcctgcttcggagcgggaatcttcgttgcgc cagcgactaaaaagagaattaaatattggtgatgttgagaaaggcaagaagatttttatt atgaagtgttcccagtgccacaccgttgaaaaggaaggcaagcacaagactgggccaaat ctccatggtctcttcgggcggaagacaggtcaggcccctggatactcttacacagccgcc aataagaacaaaggcatcacctggggagaggatacactgatggagtatttggagaatccc aagaagtacatccctggaacaaaaatgatctttgttggcactaagaagaacgaagaaagg gcagacttgatagcttatctcaaaaaagctactaatgagtaa

DBGET integrated database retrieval system