Macaca mulatta (rhesus monkey): 711889 Help Entry 711889            CDS       T01028                                  Symbol MYL6 Name (RefSeq) myosin light polypeptide 6   KO K12751   myosin light chain 6 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04270   Vascular smooth muscle contraction mcc04530   Tight junction mcc04814   Motor proteins mcc04921   Oxytocin signaling pathway Brite KEGG Orthology (KO) [BR:mcc00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     711889 (MYL6)   09142 Cell motility    04814 Motor proteins     711889 (MYL6)  09150 Organismal Systems   09152 Endocrine system    04921 Oxytocin signaling pathway     711889 (MYL6)   09153 Circulatory system    04270 Vascular smooth muscle contraction     711889 (MYL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mcc04812]     711889 (MYL6)    04147 Exosome [BR:mcc04147]     711889 (MYL6) Cytoskeleton proteins [BR:mcc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      711889 (MYL6) Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    711889 (MYL6)   Exosomal proteins of bladder cancer cells    711889 (MYL6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 AIF-1 EF-hand_9 EF-hand_5 Motif Other DBs NCBI-GeneID:  711889 NCBI-ProteinID:  NP_001180478 Ensembl:  ENSMMUG00000031838 UniProt:  H9YV18 LinkDB All DBs Position 11:55719938..55723211 Genome browser AA seq 151 aa AA seqDB search MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEM NVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKM TEEEVEMLVAGHEDSNGCINYEAFVRHILSG NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtgtgacttcaccgaagaccagaccgcagagttcaaggaggccttccagctgtttgac cgaacaggtgatggcaagatcctgtacagccagtgtggggacgtgatgagggccctgggc cagaaccctaccaacgccgaggtgctcaaggtcctggggaaccccaagagtgatgagatg aacgtgaaggtgctggactttgagcactttctgcccatgctgcagacagtggccaagaac aaggaccagggcacctatgaggattatgtcgaaggacttcgggtgtttgacaaggaagga aatggcactgtcatgggtgctgaaatccggcatgttcttgtcacactgggtgagaagatg acagaggaagaagtagagatgctggtggcagggcacgaggacagcaatggttgtatcaac tatgaagcgtttgtgaggcatatcctgtcggggtga

DBGET integrated database retrieval system