Macaca mulatta (rhesus monkey): 712193 Help Entry 712193            CDS       T01028                                  Symbol PSMB2 Name (RefSeq) proteasome subunit beta type-2   KO K02734   20S proteasome subunit beta 4 [EC:3.4.25.1] Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc03050   Proteasome mcc05010   Alzheimer disease mcc05012   Parkinson disease mcc05014   Amyotrophic lateral sclerosis mcc05016   Huntington disease mcc05017   Spinocerebellar ataxia mcc05020   Prion disease mcc05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:mcc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     712193 (PSMB2)  09160 Human Diseases   09164 Neurodegenerative disease    05010 Alzheimer disease     712193 (PSMB2)    05012 Parkinson disease     712193 (PSMB2)    05014 Amyotrophic lateral sclerosis     712193 (PSMB2)    05016 Huntington disease     712193 (PSMB2)    05017 Spinocerebellar ataxia     712193 (PSMB2)    05020 Prion disease     712193 (PSMB2)    05022 Pathways of neurodegeneration - multiple diseases     712193 (PSMB2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:mcc01002]     712193 (PSMB2)   09182 Protein families: genetic information processing    03051 Proteasome [BR:mcc03051]     712193 (PSMB2) Enzymes [BR:mcc01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.25  Threonine endopeptidases     3.4.25.1  proteasome endopeptidase complex      712193 (PSMB2) Peptidases and inhibitors [BR:mcc01002]  Threonine peptidases   Family T1: proteasome family    712193 (PSMB2) Proteasome [BR:mcc03051]  Eukaryotic proteasome   Core particles (20S proteasome)    beta type subunits     712193 (PSMB2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Proteasome WSLR Motif Other DBs NCBI-GeneID:  712193 NCBI-ProteinID:  NP_001244354 Ensembl:  ENSMMUG00000013090 UniProt:  F6XJL9 A0A8J8XXX8 LinkDB All DBs Position 1:188979293..189017385 Genome browser AA seq 201 aa AA seqDB search MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV RIIDKNGIHDLDNISFPKQGS NT seq 606 nt NT seq  +upstreamnt  +downstreamnt atggagtacctaatcggtatccaaggccccgactatgtccttgtcgcctccgaccgggtg gccgccagcaatattgtccagatgaaggacgatcatgacaagatgtttaagatgagtgaa aagatattactgctgtgtgtgggagaggctggagacactgtacagtttgcagaatatatt cagaaaaacgtgcaactttataagatgcgaaatggatatgaattgtctcccacagcagca gctaacttcacacgtcgaaacctggctgactgtcttcggagtcggaccccatatcatgtg aacctcctcctggctggctatgatgagcatgaagggccagcgctctattacatggactac cttgcagccttggccaaggccccttttgcagcccatggctatggtgccttcctgactctc agtatcctagaccgatactacacaccgactatctcacgtgagagggcagtggagcttctt aggaaatgtctggaggagctccagaaacgcttcatcctgaatctgccaaccttcagtgtt cgaatcattgacaaaaatggcatccatgacctggacaacatttccttccccaaacagggc tcctaa

DBGET integrated database retrieval system