Macaca mulatta (rhesus monkey): 712849 Help Entry 712849            CDS       T01028                                  Symbol HMGB1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc03410   Base excision repair mcc04140   Autophagy - animal mcc04217   Necroptosis mcc04613   Neutrophil extracellular trap formation Brite KEGG Orthology (KO) [BR:mcc00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     712849 (HMGB1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     712849 (HMGB1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     712849 (HMGB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcc03036]     712849 (HMGB1)    03400 DNA repair and recombination proteins [BR:mcc03400]     712849 (HMGB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     712849 (HMGB1) Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     712849 (HMGB1) DNA repair and recombination proteins [BR:mcc03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      712849 (HMGB1)    MMR (mismatch excision repair)     Other MMR factors      712849 (HMGB1) Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    712849 (HMGB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 NOA36 HMG_box_5 Nop14 Motif Other DBs NCBI-GeneID:  712849 NCBI-ProteinID:  NP_001252735 Ensembl:  ENSMMUG00000046615 UniProt:  F6Y7C3 LinkDB All DBs Position 17:complement(9529287..9684084) Genome browser AA seq 215 aa AA seqDB search MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK SKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaggagatcctaagaagccgagaggcaaaatgtcatcatatgcattttttgtg caaacttgtcgggaggagcataagaagaagcacccagatgcttcagtcaacttctcagag ttttctaagaagtgctcagagaggtggaagaccatgtctgctaaagagaaaggaaaattt gaagatatggcaaaggcggacaaggcccgttacgaaagagaaatgaaaacctatatccct cccaaaggggagacaaaaaagaagttcaaggatcccaatgcacccaagaggcctccttcg gccttcttcctgttctgctctgagtatcgcccaaaaatcaaaggagaacatcctggcctg tccattggtgatgttgcgaagaaactgggagagatgtggaataacactgctgcagatgac aagcagccttatgaaaagaaggctgcgaagctgaaggaaaaatacgaaaaggatattgct gcatatcgagctaaaggaaagcctgatgcagcaaaaaagggagttgtcaaggctgaaaaa agcaagaaaaagaaggaagaggaggaagatgaggaagatgaagaggatgaggaggaggag gaagatgaagaagatgaagatgaagaagaagatgatgatgatgaataa

DBGET integrated database retrieval system