Macaca mulatta (rhesus monkey): 713988 Help Entry 713988            CDS       T01028                                  Symbol PPY Name (RefSeq) pancreatic hormone precursor   KO K05234   pancreatic polypeptide Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     713988 (PPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     713988 (PPY) Cytokines and neuropeptides [BR:mcc04052]  Neuropeptides   GPCR binding    713988 (PPY) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  713988 NCBI-ProteinID:  NP_001180358 Ensembl:  ENSMMUG00000003206 UniProt:  G7NIW2 LinkDB All DBs Position 16:complement(55189998..55193290) Genome browser AA seq 95 aa AA seqDB search MAATRLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINML TRPRYGKRHKEDTLAFSEWGSPHAAAPRELSPLDL NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctgccacacgcctctgcctttctctgctgctcctgtccacctgtgtggctctgtta ctacagccactgctgggtgcccagggagccccgctggagccagtgtacccaggggacaat gccacgccagagcagatggcccagtatgcggctgatctccgtagatacatcaacatgctg accagacctaggtatgggaaaagacacaaagaggacacgctggccttctcggagtggggg tccccgcatgctgctgcccccagggagctcagcccgctggacttgtaa

DBGET integrated database retrieval system