Macaca mulatta (rhesus monkey): 714547 Help Entry 714547            CDS       T01028                                  Symbol CSTA Name (RefSeq) cystatin-A   KO K13907   cystatin-A/B Organism mcc  Macaca mulatta (rhesus monkey) Brite KEGG Orthology (KO) [BR:mcc00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:mcc01002]     714547 (CSTA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     714547 (CSTA) Peptidases and inhibitors [BR:mcc01002]  Peptidase inhibitors   Family I25: cystatin family    714547 (CSTA) Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    714547 (CSTA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin SQAPI Mg296 Motif Other DBs NCBI-GeneID:  714547 NCBI-ProteinID:  NP_001245071 Ensembl:  ENSMMUG00000006269 UniProt:  F7H310 A0A8J8XQZ7 LinkDB All DBs Position 2:complement(153970849..153987384) Genome browser AA seq 98 aa AA seqDB search MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNQSYEKLEAVEYKTQVVAGINYYIKVRAG DNHYMHLKVFKSLPGQNEDLVLTGYQADKNKDDELTGF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatacctggaggcttatctgaggccaaacccgccactccagaaatccaggagattgtt gataaggttaaaccacagcttgaagaaaaaacaaaccagagttatgaaaaattggaagct gtggagtataaaactcaagtcgttgctggaataaattactacattaaggtacgagcaggt gataatcattatatgcacttgaaagtattcaaaagtcttcccggacaaaatgaggacttg gtacttactggataccaggctgacaaaaacaaggacgatgagctgacgggtttttag

DBGET integrated database retrieval system