Macaca mulatta (rhesus monkey): 714647 Help Entry 714647            CDS       T01028                                  Symbol CLDN7 Name (RefSeq) claudin-7   KO K06087   claudin Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc03272   Virion - Hepatitis viruses mcc04382   Cornified envelope formation mcc04514   Cell adhesion molecule (CAM) interaction mcc04530   Tight junction mcc04670   Leukocyte transendothelial migration mcc05160   Hepatitis C Brite KEGG Orthology (KO) [BR:mcc00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     714647 (CLDN7)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     714647 (CLDN7)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     714647 (CLDN7)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     714647 (CLDN7)   09158 Development and regeneration    04382 Cornified envelope formation     714647 (CLDN7)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     714647 (CLDN7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mcc03037]     714647 (CLDN7)    04147 Exosome [BR:mcc04147]     714647 (CLDN7) Cilium and associated proteins [BR:mcc03037]  Other cilia and associated proteins   Stereociliary proteins    714647 (CLDN7) Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    714647 (CLDN7)   Exosomal proteins of colorectal cancer cells    714647 (CLDN7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF7847 Clc-like OppC_N Motif Other DBs NCBI-GeneID:  714647 NCBI-ProteinID:  XP_001107265 Ensembl:  ENSMMUG00000010551 UniProt:  A0A1D5RHW0 LinkDB All DBs Position 16:complement(7027849..7030917) Genome browser AA seq 211 aa AA seqDB search MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTG MMSCKMYDSVLALPAAMQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAM GGGIIFIVAGLAALIACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGA LLSCSCPRNESKAGYHAPRSYPKSNSSKEYV NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggccaattcgggcctgcagttgctgggcttctccatggccctgctgggctgggtgggt ctggtggcctgcaccgccatcccgcagtggcagatgagctcctatgcgggcgacaacatc atcacggcccaggccatgtacaaggggctgtggatggactgcgtcacgcagagcacgggg atgatgagctgcaaaatgtacgactcggtgctcgccctgcccgcggctatgcaggccact cgagccctaatggtggtctccctggtgctgggcttcctggccatgtttgtggccacgatg ggcatgaagtgcacacgctgtgggggagacgacaaagtgaagaaggcccgtatagccatg ggtggaggcataattttcatcgtggcaggtcttgccgccttgatagcttgctcctggtat ggccatcagattgtcacagacttttataaccccttgatccctaccaacattaagtatgag tttggtcctgccatctttattggctgggcagggtctgccctagtcatcctgggaggtgca ctgctctcctgttcctgtcctaggaatgagagcaaggctgggtaccatgcaccccgttct taccctaagtccaactcttccaaggagtatgtgtga

DBGET integrated database retrieval system