Macaca mulatta (rhesus monkey): 715378 Help Entry 715378            CDS       T01028                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04072   Phospholipase D signaling pathway mcc04140   Autophagy - animal mcc04150   mTOR signaling pathway mcc04151   PI3K-Akt signaling pathway mcc04152   AMPK signaling pathway mcc04211   Longevity regulating pathway mcc04218   Cellular senescence mcc04714   Thermogenesis mcc04910   Insulin signaling pathway mcc04919   Thyroid hormone signaling pathway mcc05163   Human cytomegalovirus infection mcc05165   Human papillomavirus infection mcc05168   Herpes simplex virus 1 infection mcc05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     715378 (RHEB)    04151 PI3K-Akt signaling pathway     715378 (RHEB)    04152 AMPK signaling pathway     715378 (RHEB)    04150 mTOR signaling pathway     715378 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     715378 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     715378 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     715378 (RHEB)    04919 Thyroid hormone signaling pathway     715378 (RHEB)   09149 Aging    04211 Longevity regulating pathway     715378 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     715378 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     715378 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     715378 (RHEB)    05163 Human cytomegalovirus infection     715378 (RHEB)    05165 Human papillomavirus infection     715378 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mcc04031]     715378 (RHEB) GTP-binding proteins [BR:mcc04031]  Small (monomeric) G-proteins   Ras Family    Rheb     715378 (RHEB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  715378 NCBI-ProteinID:  NP_001248111 UniProt:  F7H5C5 LinkDB All DBs Position 3:complement(177465325..177517200) Genome browser AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcattgacgattcaatttgttgaaggccaatttgtggactcctacgatccaaccatagaa aacacttttacaaagttgatcacagtaaatggacaagaatatcatcttcaacttgtagac acagctgggcaagatgaatattctatctttcctcagacctactccatagatattaatggc tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagttatccat gggaaattattggatatggtggggaaagtacaaatacctattatgttggttgggaataag aaagacctgcatatggaaagggtgatcagttatgaagaagggaaagctttggcagaatct tggaatgcagcttttttggaatcttctgctaaagaaaatcagactgctgttgatgttttt agaaggataattttggaggcagaaaaaatggatggggcagcttcacaaggcaagtcttca tgctcggtgatgtga

DBGET integrated database retrieval system