Macaca mulatta (rhesus monkey): 715807 Help Entry 715807            CDS       T01028                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc03008   Ribosome biogenesis in eukaryotes mcc03083   Polycomb repressive complex mcc04064   NF-kappa B signaling pathway mcc04137   Mitophagy - animal mcc04310   Wnt signaling pathway mcc04520   Adherens junction mcc05010   Alzheimer disease mcc05020   Prion disease mcc05022   Pathways of neurodegeneration - multiple diseases mcc05162   Measles mcc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:mcc00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     715807 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     715807 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     715807 (CSNK2B)    04064 NF-kappa B signaling pathway     715807 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     715807 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     715807 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     715807 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     715807 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     715807 (CSNK2B)    05020 Prion disease     715807 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     715807 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:mcc03009]     715807 (CSNK2B)    03036 Chromosome and associated proteins [BR:mcc03036]     715807 (CSNK2B) Ribosome biogenesis [BR:mcc03009]  Eukaryotic type   90S particles    Kinase     715807 (CSNK2B) Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      715807 (CSNK2B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  715807 NCBI-ProteinID:  NP_001244617 Ensembl:  ENSMMUG00000005294 UniProt:  H9ENN4 LinkDB All DBs Position 4:complement(137834581..137839385) Genome browser AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcagaggaggtgtcctggatttcctggttctgtgggctccgtggcaatgaa ttcttctgtgaagtggatgaagactacatccaggacaaatttaatcttactggactcaat gagcaggttcctcactatcgacaagctctagacatgatcttggacctggagcctgatgaa gaactggaagacaaccccaaccagagtgacctgattgagcaggctgccgagatgctttat ggattgatccacgcccgctacatccttaccaaccgtggcattgcccagatgttggaaaag taccagcagggagactttggttactgtcctcgtgtgtactgtgagaaccagccaatgctt cccatcggcctttcagacatcccaggtgaagccatggtgaagctctactgccccaagtgc atggatgtgtacacacccaagtcatcgagacaccatcacacggatggcgcctactttggc actggtttccctcacatgctcttcatggtgcatcccgagtaccggcccaagagacccgcc aaccagtttgtgcccaggctctacggtttcaagattcatccgatggcctaccagctgcag ctccaagccgccagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system