Macaca mulatta (rhesus monkey): 715899 Help Entry 715899            CDS       T01028                                  Symbol BRK1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04810   Regulation of actin cytoskeleton mcc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mcc00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     715899 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     715899 (BRK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 SPX LXG Matrilin_ccoil Motif Other DBs NCBI-GeneID:  715899 NCBI-ProteinID:  XP_014985737 Ensembl:  ENSMMUG00000045652 UniProt:  H9Z3A3 LinkDB All DBs Position 2:141512406..141525844 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgggacaggaggatccggtgcagcgggagattcaccaggactgggctaaccgagag tacattgagataatcaccagcagcatcaagaaaatcgcggactttctcaactcgttcgat atgtcttgtcgttcaagacttgcaacactaaacgagaaattgacagcccttgaacggaga atagagtacattgaagcacgggtgacaaaaggtgagacactcacctag

DBGET integrated database retrieval system