Macaca mulatta (rhesus monkey): 716099 Help Entry 716099            CDS       T01028                                  Symbol CCL26 Name (RefSeq) C-C motif chemokine 26   KO K21096   C-C motif chemokine 26 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04060   Cytokine-cytokine receptor interaction mcc04061   Viral protein interaction with cytokine and cytokine receptor mcc04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     716099 (CCL26)    04061 Viral protein interaction with cytokine and cytokine receptor     716099 (CCL26)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     716099 (CCL26)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     716099 (CCL26) Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Chemokines    716099 (CCL26) SSDB OrthologParalogGFIT Motif Pfam:  IL8 UL128 bPH_7 DUF1980 Gln_deamidase_2 Motif Other DBs NCBI-GeneID:  716099 NCBI-ProteinID:  XP_028701500 Ensembl:  ENSMMUG00000015735 UniProt:  F6S7Q8 LinkDB All DBs Position 3:45328483..45346225 Genome browser AA seq 94 aa AA seqDB search MMGLSVASAVILASLLSLHLGTATRGTDIAKTCCFQHSHKSLPWTRVQSYEFTSSSCSQQ AVIFTTKRGKKVCTNPKKKWVQRYISLLKTQKQL NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgatgggcctgtccgtggcctctgctgtgatcctggcgtccctcttgagtctccacctt ggaactgccacacgtgggactgacatagccaagacatgctgcttccaacacagccacaag tcccttccctggacccgggtgcaaagctatgaattcaccagtagcagctgctcccagcag gctgtaatattcactaccaaaagaggcaagaaagtctgtaccaatccaaagaaaaaatgg gtgcaaagatacatttctttattgaaaactcagaaacaattgtga

DBGET integrated database retrieval system