Macaca mulatta (rhesus monkey): 716452 Help Entry 716452            CDS       T01028                                  Symbol JUN Name (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc01522   Endocrine resistance mcc04010   MAPK signaling pathway mcc04012   ErbB signaling pathway mcc04024   cAMP signaling pathway mcc04137   Mitophagy - animal mcc04210   Apoptosis mcc04310   Wnt signaling pathway mcc04380   Osteoclast differentiation mcc04510   Focal adhesion mcc04530   Tight junction mcc04620   Toll-like receptor signaling pathway mcc04621   NOD-like receptor signaling pathway mcc04625   C-type lectin receptor signaling pathway mcc04657   IL-17 signaling pathway mcc04658   Th1 and Th2 cell differentiation mcc04659   Th17 cell differentiation mcc04660   T cell receptor signaling pathway mcc04662   B cell receptor signaling pathway mcc04668   TNF signaling pathway mcc04722   Neurotrophin signaling pathway mcc04912   GnRH signaling pathway mcc04915   Estrogen signaling pathway mcc04921   Oxytocin signaling pathway mcc04926   Relaxin signaling pathway mcc04932   Non-alcoholic fatty liver disease mcc04933   AGE-RAGE signaling pathway in diabetic complications mcc05030   Cocaine addiction mcc05031   Amphetamine addiction mcc05132   Salmonella infection mcc05133   Pertussis mcc05135   Yersinia infection mcc05140   Leishmaniasis mcc05142   Chagas disease mcc05161   Hepatitis B mcc05162   Measles mcc05166   Human T-cell leukemia virus 1 infection mcc05167   Kaposi sarcoma-associated herpesvirus infection mcc05169   Epstein-Barr virus infection mcc05170   Human immunodeficiency virus 1 infection mcc05171   Coronavirus disease - COVID-19 mcc05200   Pathways in cancer mcc05203   Viral carcinogenesis mcc05207   Chemical carcinogenesis - receptor activation mcc05208   Chemical carcinogenesis - reactive oxygen species mcc05210   Colorectal cancer mcc05211   Renal cell carcinoma mcc05224   Breast cancer mcc05231   Choline metabolism in cancer mcc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mcc05321   Inflammatory bowel disease mcc05323   Rheumatoid arthritis mcc05417   Lipid and atherosclerosis mcc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     716452 (JUN)    04668 TNF signaling pathway     716452 (JUN)    04024 cAMP signaling pathway     716452 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     716452 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     716452 (JUN)    04660 T cell receptor signaling pathway     716452 (JUN)    04658 Th1 and Th2 cell differentiation     716452 (JUN)    04659 Th17 cell differentiation     716452 (JUN)    04657 IL-17 signaling pathway     716452 (JUN)    04662 B cell receptor signaling pathway     716452 (JUN)   09152 Endocrine system    04915 Estrogen signaling pathway     716452 (JUN)    04921 Oxytocin signaling pathway     716452 (JUN)    04926 Relaxin signaling pathway     716452 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     716452 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     716452 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     716452 (JUN)    05207 Chemical carcinogenesis - receptor activation     716452 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     716452 (JUN)    05203 Viral carcinogenesis     716452 (JUN)    05231 Choline metabolism in cancer     716452 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     716452 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     716452 (JUN)    05211 Renal cell carcinoma     716452 (JUN)    05224 Breast cancer     716452 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     716452 (JUN)    05170 Human immunodeficiency virus 1 infection     716452 (JUN)    05161 Hepatitis B     716452 (JUN)    05171 Coronavirus disease - COVID-19     716452 (JUN)    05162 Measles     716452 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     716452 (JUN)    05169 Epstein-Barr virus infection     716452 (JUN)   09171 Infectious disease: bacterial    05135 Yersinia infection     716452 (JUN)    05133 Pertussis     716452 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     716452 (JUN)    05142 Chagas disease     716452 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     716452 (JUN)    05321 Inflammatory bowel disease     716452 (JUN)   09165 Substance dependence    05030 Cocaine addiction     716452 (JUN)    05031 Amphetamine addiction     716452 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     716452 (JUN)    05418 Fluid shear stress and atherosclerosis     716452 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     716452 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     716452 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     716452 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mcc03000]     716452 (JUN) Transcription factors [BR:mcc03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     716452 (JUN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha DUF3450 FlaC_arch TFIIA Motif Other DBs NCBI-GeneID:  716452 NCBI-ProteinID:  NP_001252779 UniProt:  F7A6Z1 A0A8J8XF04 LinkDB All DBs Position 1:165651412..165653728 Genome browser AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLPSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQPPPQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctatgatgatgccctcaacgcctcgttcctcccg tccgagagcggagcttatggctacagtaaccccaagatcctgaaacagagcatgaccctg aacctggccgacccagtggggagcctgaagccgcacctccgcgccaagaactcggacctc ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc aagaacgtgacagacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcagcggcgcagccggtcagcggggcg ggcatggtagctccagcggtagcctcggtggcagggggcagcggcagcggaggcttcagc gccagcctgcacagcgagccgcccgtctacgccaacctcagcaacttcaacccaggcgcg ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcaa ccccagcagcagcagccgccgccgcagccgccgcaccacctgccccagcagatgcccgtg cagcacccgcggctgcaagccctgaaggaggagcctcagacagtgcccgagatgcctggc gagacgccgcccctgtcccccattgacatggagtcccaggagcggatcaaggcggagagg aagcgtatgaggaaccgcattgctgcctccaagtgccgaaaaaggaagctggagagaatc gcccggctggaggaaaaagtgaaaaccttgaaagctcagaactcggagctggcgtccacg gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtgggtgccaactcatgctaacgcagcagttgcaaacattttga

DBGET integrated database retrieval system