Macaca mulatta (rhesus monkey): 716808 Help Entry 716808            CDS       T01028                                  Symbol CLDN4 Name (RefSeq) claudin-4   KO K06087   claudin Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc03272   Virion - Hepatitis viruses mcc04382   Cornified envelope formation mcc04514   Cell adhesion molecule (CAM) interaction mcc04530   Tight junction mcc04670   Leukocyte transendothelial migration mcc05160   Hepatitis C Brite KEGG Orthology (KO) [BR:mcc00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     716808 (CLDN4)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     716808 (CLDN4)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     716808 (CLDN4)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     716808 (CLDN4)   09158 Development and regeneration    04382 Cornified envelope formation     716808 (CLDN4)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     716808 (CLDN4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mcc03037]     716808 (CLDN4)    04147 Exosome [BR:mcc04147]     716808 (CLDN4) Cilium and associated proteins [BR:mcc03037]  Other cilia and associated proteins   Stereociliary proteins    716808 (CLDN4) Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    716808 (CLDN4)   Exosomal proteins of colorectal cancer cells    716808 (CLDN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 TMEM_230_134 TMEM37 Motif Other DBs NCBI-GeneID:  716808 NCBI-ProteinID:  NP_001181493 Ensembl:  ENSMMUG00000044653 UniProt:  F6YR27 A0A8J8YFZ1 LinkDB All DBs Position 3:46191205..46193024 Genome browser AA seq 209 aa AA seqDB search MASMGLQVTGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTG QMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIV AGVVFLLAGLLVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGL LCCNCPPRTDKPYSAKYSAARSAAASNYV NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atggcctccatggggctacaggtgacgggcatcgcgctggccgtcctgggctggctggcc gtcatgctgtgctgcgcgctgcccatgtggcgcgtgacggccttcatcggcagcaacatc gtcacctcgcagaccatctgggagggcctgtggatgaactgcgtggtgcagagcaccggc cagatgcagtgcaaggtgtacgactcgctgctggcgctgccgcaggacctgcaggcggcc cgcgccctcgtcatcatcagcatcatcgtggccgctctgggcgtgctgctgtccgtggtg gggggcaagtgtacaaactgcctggaggatgagagtgccaaggccaagaccatgatcgtg gcgggtgtggtgttcctgttggccggcctgctggtgatagtgcccgtgtcctggacggcc cacaacatcatccaagacttctacaacccgctggtggcctccgggcagaagcgggagatg ggtgcctcgctctacgtcggctgggctgcctccggcctgctgctgcttggcggggggctg ctttgctgcaactgcccaccccgcacagacaagccttactctgccaagtattctgccgcc cgctctgctgctgccagcaactacgtgtaa

DBGET integrated database retrieval system