Macaca mulatta (rhesus monkey): 717686 Help Entry 717686            CDS       T01028                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04014   Ras signaling pathway mcc04015   Rap1 signaling pathway mcc04020   Calcium signaling pathway mcc04022   cGMP-PKG signaling pathway mcc04024   cAMP signaling pathway mcc04070   Phosphatidylinositol signaling system mcc04114   Oocyte meiosis mcc04218   Cellular senescence mcc04261   Adrenergic signaling in cardiomyocytes mcc04270   Vascular smooth muscle contraction mcc04371   Apelin signaling pathway mcc04625   C-type lectin receptor signaling pathway mcc04713   Circadian entrainment mcc04720   Long-term potentiation mcc04722   Neurotrophin signaling pathway mcc04728   Dopaminergic synapse mcc04740   Olfactory transduction mcc04744   Phototransduction mcc04750   Inflammatory mediator regulation of TRP channels mcc04910   Insulin signaling pathway mcc04912   GnRH signaling pathway mcc04915   Estrogen signaling pathway mcc04916   Melanogenesis mcc04921   Oxytocin signaling pathway mcc04922   Glucagon signaling pathway mcc04924   Renin secretion mcc04925   Aldosterone synthesis and secretion mcc04970   Salivary secretion mcc04971   Gastric acid secretion mcc05010   Alzheimer disease mcc05012   Parkinson disease mcc05022   Pathways of neurodegeneration - multiple diseases mcc05031   Amphetamine addiction mcc05034   Alcoholism mcc05133   Pertussis mcc05152   Tuberculosis mcc05163   Human cytomegalovirus infection mcc05167   Kaposi sarcoma-associated herpesvirus infection mcc05170   Human immunodeficiency virus 1 infection mcc05200   Pathways in cancer mcc05214   Glioma mcc05417   Lipid and atherosclerosis mcc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     717686    04015 Rap1 signaling pathway     717686    04371 Apelin signaling pathway     717686    04020 Calcium signaling pathway     717686    04070 Phosphatidylinositol signaling system     717686    04024 cAMP signaling pathway     717686    04022 cGMP-PKG signaling pathway     717686  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     717686    04218 Cellular senescence     717686  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     717686   09152 Endocrine system    04910 Insulin signaling pathway     717686    04922 Glucagon signaling pathway     717686    04912 GnRH signaling pathway     717686    04915 Estrogen signaling pathway     717686    04921 Oxytocin signaling pathway     717686    04916 Melanogenesis     717686    04924 Renin secretion     717686    04925 Aldosterone synthesis and secretion     717686   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     717686    04270 Vascular smooth muscle contraction     717686   09154 Digestive system    04970 Salivary secretion     717686    04971 Gastric acid secretion     717686   09156 Nervous system    04728 Dopaminergic synapse     717686    04720 Long-term potentiation     717686    04722 Neurotrophin signaling pathway     717686   09157 Sensory system    04744 Phototransduction     717686    04740 Olfactory transduction     717686    04750 Inflammatory mediator regulation of TRP channels     717686   09159 Environmental adaptation    04713 Circadian entrainment     717686  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     717686   09162 Cancer: specific types    05214 Glioma     717686   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     717686    05163 Human cytomegalovirus infection     717686    05167 Kaposi sarcoma-associated herpesvirus infection     717686   09171 Infectious disease: bacterial    05133 Pertussis     717686    05152 Tuberculosis     717686   09164 Neurodegenerative disease    05010 Alzheimer disease     717686    05012 Parkinson disease     717686    05022 Pathways of neurodegeneration - multiple diseases     717686   09165 Substance dependence    05031 Amphetamine addiction     717686    05034 Alcoholism     717686   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     717686    05418 Fluid shear stress and atherosclerosis     717686  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mcc01009]     717686   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcc04131]     717686    03036 Chromosome and associated proteins [BR:mcc03036]     717686   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     717686 Protein phosphatases and associated proteins [BR:mcc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      717686 Membrane trafficking [BR:mcc04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     717686 Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      717686 Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    717686 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C Dockerin_1 SPARC_Ca_bdg EF-hand_11 EFhand_Ca_insen UPF0154 TerB DUF1103 DUF5580_M FCaBP_EF-hand Poly_export SPEF2_C SurA_N_3 Fe_hyd_lg_C PA_Ig-like Motif Other DBs NCBI-GeneID:  717686 NCBI-ProteinID:  XP_001109440 UniProt:  F7EDG2 LinkDB All DBs Position 3:63388783..63389915 Genome browser AA seq 149 aa AA seqDB search MADQLTEEQIAEFKEAFPLFDKDGDGTITTKELGTVMRYLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgaccaactgacagaagagcagattgcagaattcaaagaagcttttccactattt gacaaagatggtgatggaactataacaacaaaggaattgggaactgtaatgaggtatctt gggcagaatcccacagaagcagagttacaggacatgattaatgaagtagatgctgatggt aatggcacaattgacttccctgaatttctgacaatgatggcaagaaaaatgaaagacaca gacagtgaagaagaaattagagaagcattccgtgtgtttgataaggatggcaatggctat attagtgctgcagaacttcgccatgtgatgacaaaccttggagagaagttaacagatgaa gaagttgatgaaatgatcagggaagcagatattgatggtgatggtcaagtaaattatgaa gagtttgtacaaatgatgacagcaaagtga

DBGET integrated database retrieval system