Macaca mulatta (rhesus monkey): 718939 Help Entry 718939            CDS       T01028                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04010   MAPK signaling pathway mcc04014   Ras signaling pathway mcc04015   Rap1 signaling pathway mcc04024   cAMP signaling pathway mcc04072   Phospholipase D signaling pathway mcc04137   Mitophagy - animal mcc04140   Autophagy - animal mcc04218   Cellular senescence mcc04360   Axon guidance mcc04371   Apelin signaling pathway mcc04625   C-type lectin receptor signaling pathway mcc04810   Regulation of actin cytoskeleton mcc05132   Salmonella infection mcc05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     718939 (RRAS)    04014 Ras signaling pathway     718939 (RRAS)    04015 Rap1 signaling pathway     718939 (RRAS)    04371 Apelin signaling pathway     718939 (RRAS)    04072 Phospholipase D signaling pathway     718939 (RRAS)    04024 cAMP signaling pathway     718939 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     718939 (RRAS)    04137 Mitophagy - animal     718939 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     718939 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     718939 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     718939 (RRAS)   09158 Development and regeneration    04360 Axon guidance     718939 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     718939 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     718939 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mcc04031]     718939 (RRAS) GTP-binding proteins [BR:mcc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     718939 (RRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  718939 NCBI-ProteinID:  XP_001115362 Ensembl:  ENSMMUG00000028733 UniProt:  H9EPG6 LinkDB All DBs Position 19:complement(49605705..49610772) Genome browser AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPVVLVGNKADLEAQRQVPRSEASAFGASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcgggggacctggg cccggggaccccccgcccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctacttcgtgtctgactacgacccc actattgaggactcctacacgaagatctgcagtgtggatgggatcccggcccggctggac atcctggacactgcgggccaggaggagttcggggccatgagagagcagtacatgcgtgcc ggccacggcttcctgctggtgtttgccattaacgaccggcagagtttcaacgaggtgggc aagctcttcacgcagattctccgggtcaaggaccgcgatgacttcccggtcgtgttggtc gggaacaaggcggatctggaggcacagcgccaggtcccccgatcagaagcatctgccttc ggcgcctcccaccacgtggcctactttgaggcctcggccaaactgcgtctcaacgtggac gaggcttttgagcagctggtgcgggctgtccggaaataccaggaacaagagctcccaccc agccctcccagtgcccccaggaagaagggcgggggctgcccctgcgtcctcctgtag

DBGET integrated database retrieval system