Microbulbifer celer: LPW13_06825 Help Entry LPW13_06825       CDS       T07789                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mcel  Microbulbifer celer Pathway mcel01100   Metabolic pathways mcel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mcel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LPW13_06825 (acpP)    00074 Mycolic acid biosynthesis     LPW13_06825 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LPW13_06825 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH DUF1896 Motif Other DBs NCBI-ProteinID:  UFN58747 LinkDB All DBs Position 1625254..1625490 Genome browser AA seq 78 aa AA seqDB search MSSIEERVKKIVAEQLGVKEEDVKPEASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQLAIDYINQNLG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcagcattgaagagcgcgtaaaaaagatcgttgctgaacaactgggcgtgaaggaa gaagatgtaaaacctgaagcatcctttgttgaagatctgggcgctgactccctcgacaca gttgagctggtaatggctttggaagaggaattcgaaaccgagattccggacgaagaagcg gaaaaaattacaactgttcagctggcaatcgactacatcaatcagaaccttggttga

DBGET integrated database retrieval system