Mugil cephalus (flathead mullet): 125006633 Help Entry 125006633         CDS       T08342                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism mcep  Mugil cephalus (flathead mullet) Pathway mcep04137   Mitophagy - animal mcep04140   Autophagy - animal mcep04144   Endocytosis mcep04145   Phagosome mcep04148   Efferocytosis mcep05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mcep00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     125006633    04145 Phagosome     125006633    04140 Autophagy - animal     125006633    04137 Mitophagy - animal     125006633    04148 Efferocytosis     125006633  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125006633  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcep04131]     125006633   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcep04147]     125006633    04031 GTP-binding proteins [BR:mcep04031]     125006633 Membrane trafficking [BR:mcep04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     125006633 Exosome [BR:mcep04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125006633   Exosomal proteins of other body fluids (saliva and urine)    125006633   Exosomal proteins of colorectal cancer cells    125006633   Exosomal proteins of bladder cancer cells    125006633 GTP-binding proteins [BR:mcep04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     125006633 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  125006633 NCBI-ProteinID:  XP_047438819 LinkDB All DBs Position 4:20009755..20014661 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERAKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacgtcaaggaagaaagtactactcaaagtcatcatcctcggagactctggagttgga aagacctcgttgatgaatcagtatgtgaataagaagttcagcaaccagtacaaagccaca ataggtgctgatttcttgacgaaagaagtcatggtggatgacagacttgtcacaatgcag atttgggacacagcaggtcaagagaggttccagtctttaggtgtagcgttctaccgtgga gcggactgttgcgtcctggtgtttgacgtgactgcacccaacaccttcaagaccctagac agctggagggacgagttcttgatccaggccagcccacgagacccggagaattttcccttt gtggtgctgggcaacaagatcgacttggagaatagacaggtaacaaccaagcgagcacag gcttggtgtcagagcaagaacaacatcccatattttgaaaccagcgctaaggaggcaatc aacgtggagcaggctttccagactattgcacgcaatgctctcaaacaggagaccgaagtg gagttgtacaacgagttccctgagccaataaagctggacaggaacgagcgggccaagccg tcagccgagacctgcagctgctga

DBGET integrated database retrieval system