Mugil cephalus (flathead mullet): 125006804 Help Entry 125006804         CDS       T08342                                  Symbol myl2a Name (RefSeq) myosin regulatory light chain 2a   KO K10351   myosin regulatory light chain 2 Organism mcep  Mugil cephalus (flathead mullet) Pathway mcep04260   Cardiac muscle contraction mcep04261   Adrenergic signaling in cardiomyocytes mcep04371   Apelin signaling pathway mcep04510   Focal adhesion mcep04520   Adherens junction mcep04530   Tight junction mcep04810   Regulation of actin cytoskeleton mcep04814   Motor proteins mcep04820   Cytoskeleton in muscle cells mcep05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mcep00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     125006804 (myl2a)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     125006804 (myl2a)    04520 Adherens junction     125006804 (myl2a)    04530 Tight junction     125006804 (myl2a)   09142 Cell motility    04814 Motor proteins     125006804 (myl2a)    04820 Cytoskeleton in muscle cells     125006804 (myl2a)    04810 Regulation of actin cytoskeleton     125006804 (myl2a)  09150 Organismal Systems   09153 Circulatory system    04260 Cardiac muscle contraction     125006804 (myl2a)    04261 Adrenergic signaling in cardiomyocytes     125006804 (myl2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125006804 (myl2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mcep04812]     125006804 (myl2a) Cytoskeleton proteins [BR:mcep04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      125006804 (myl2a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF_EFCAB10_C Motif Other DBs NCBI-GeneID:  125006804 NCBI-ProteinID:  XP_047439165 LinkDB All DBs Position 4:21665978..21668201 Genome browser AA seq 169 aa AA seqDB search MAPKKAKKRTAEGANSNVFSMFEQAQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRL NVKQEEIDEMLKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLRKDYV TQMLTTQADRFSAEEMEQMFTAFPPDVAGNLDYKNLVHIITHGEEKDQE NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atggcgcccaagaaagccaagaagagaacagcagagggagccaactccaatgtcttctcc atgtttgagcaggcccagatccaggagttcaaagaggccttcactatcatggaccagaac agagacggcttcatcgacaagaacgacctgagggacacttttgctgctctaggacgtctg aatgtgaaacaggaggagatcgacgagatgctcaaagaggcccccggccccatcaacttc accgtcttcctcaccatgtttggcgagaagctgaaaggtgctgatccagaggagaccatc ctcaacgcttttaaagtctttgaccctgaggggaaaggtgtgctgagaaaggactacgtg acacagatgctgacgacacaagccgaccggttctccgctgaagagatggagcagatgttc actgccttccctccagatgtggcaggaaacctggactacaagaacctggttcatatcatt actcacggcgaggagaaggaccaggagtga

DBGET integrated database retrieval system