Mugil cephalus (flathead mullet): 125008970 Help Entry 125008970         CDS       T08342                                  Symbol smx5 Name (RefSeq) smx5   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism mcep  Mugil cephalus (flathead mullet) Pathway mcep03018   RNA degradation mcep03040   Spliceosome Brite KEGG Orthology (KO) [BR:mcep00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     125008970 (smx5)   09123 Folding, sorting and degradation    03018 RNA degradation     125008970 (smx5)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mcep03019]     125008970 (smx5)    03041 Spliceosome [BR:mcep03041]     125008970 (smx5) Messenger RNA biogenesis [BR:mcep03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      125008970 (smx5)   mRNA degradation factors    5'-3' decay     Lsm complex      125008970 (smx5) Spliceosome [BR:mcep03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     125008970 (smx5)  Complex C   U2 snRNP components     125008970 (smx5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM SM-ATX DYW_deaminase Motif Other DBs NCBI-GeneID:  125008970 NCBI-ProteinID:  XP_047442364 LinkDB All DBs Position 6:complement(11977326..11980225) Genome browser AA seq 95 aa AA seqDB search MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNC FIRGSVVRYVQLPADEVDTQLLQDAARKEAMQQKQ NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgcttttctactcgtttttcaagtcattggtggggaaggacgtggtggtggagctcaaa aatgacttgagcatctgtggaacccttcactccgttgaccagtacctgaacattaagctc acagacatcagtgtcacagacccagagaaatatccacatatgctgtctgtgaaaaactgt ttcatccgtggatcggtggtccgatatgttcagcttcccgcagatgaggtggacactcag ctgctgcaggacgctgcgcgaaaagaagccatgcagcagaagcagtga

DBGET integrated database retrieval system