Mugil cephalus (flathead mullet): 125013096 Help Entry 125013096         CDS       T08342                                  Symbol dynll2a Name (RefSeq) dynein, light chain, LC8-type 2a   KO K10418   dynein light chain LC8-type Organism mcep  Mugil cephalus (flathead mullet) Pathway mcep04517   IgSF CAM signaling mcep04814   Motor proteins mcep05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mcep00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     125013096 (dynll2a)  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     125013096 (dynll2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125013096 (dynll2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mcep03037]     125013096 (dynll2a)    04812 Cytoskeleton proteins [BR:mcep04812]     125013096 (dynll2a) Cilium and associated proteins [BR:mcep03037]  Motile cilia and associated proteins   Dynein arm    125013096 (dynll2a) Cytoskeleton proteins [BR:mcep04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      125013096 (dynll2a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop SpoIIIAH Ectatomin Motif Other DBs NCBI-GeneID:  125013096 NCBI-ProteinID:  XP_047449359 LinkDB All DBs Position 9:complement(8361678..8365421) Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacaggaaagctgtgatcaagaatgcagacatgtccgaggacatgcagcaggac gccgtggactgtgccacacaggccatggagaagtacaacatagagaaggacattgcagcc tacatcaagaaggaatttgacaagaagtacaaccccacctggcactgcatcgtcgggagg aacttcggcagctacgtcacccacgagacgaagcatttcatttacttctatttgggccaa gtggccatcttgcttttcaagtccggctga

DBGET integrated database retrieval system