Mugil cephalus (flathead mullet): 125015016 Help Entry 125015016         CDS       T08342                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism mcep  Mugil cephalus (flathead mullet) Pathway mcep04010   MAPK signaling pathway mcep04012   ErbB signaling pathway mcep04068   FoxO signaling pathway mcep04137   Mitophagy - animal mcep04140   Autophagy - animal mcep04144   Endocytosis mcep04150   mTOR signaling pathway mcep04210   Apoptosis mcep04218   Cellular senescence mcep04370   VEGF signaling pathway mcep04371   Apelin signaling pathway mcep04510   Focal adhesion mcep04540   Gap junction mcep04625   C-type lectin receptor signaling pathway mcep04810   Regulation of actin cytoskeleton mcep04910   Insulin signaling pathway mcep04912   GnRH signaling pathway mcep04916   Melanogenesis mcep05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mcep00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125015016    04012 ErbB signaling pathway     125015016    04370 VEGF signaling pathway     125015016    04371 Apelin signaling pathway     125015016    04068 FoxO signaling pathway     125015016    04150 mTOR signaling pathway     125015016  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     125015016    04140 Autophagy - animal     125015016    04137 Mitophagy - animal     125015016   09143 Cell growth and death    04210 Apoptosis     125015016    04218 Cellular senescence     125015016   09144 Cellular community - eukaryotes    04510 Focal adhesion     125015016    04540 Gap junction     125015016   09142 Cell motility    04810 Regulation of actin cytoskeleton     125015016  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     125015016   09152 Endocrine system    04910 Insulin signaling pathway     125015016    04912 GnRH signaling pathway     125015016    04916 Melanogenesis     125015016  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125015016  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcep04131]     125015016   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcep04147]     125015016    04031 GTP-binding proteins [BR:mcep04031]     125015016 Membrane trafficking [BR:mcep04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     125015016  Endocytosis   Macropinocytosis    Ras GTPases     125015016 Exosome [BR:mcep04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    125015016   Exosomal proteins of colorectal cancer cells    125015016 GTP-binding proteins [BR:mcep04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     125015016 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  125015016 NCBI-ProteinID:  XP_047452595 LinkDB All DBs Position 10:2092622..2111356 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagctggtggtggtgggagctggaggcgtgggcaagagtgcgctcacc atccagctcatccagaaccactttgtggatgaatatgaccccaccatcgaggattcctac aggaagcaggtggtgattgacggggagacctgcctactggacatcctggacactgcaggt caagaagagtacagcgccatgagggaccagtacatgaggacaggggagggcttcctttgt gtcttcgccatcaacaacaccaagtccttcgaggacattcaccagtacagggaacagatc aaacgcgtgaaggactcggatgatgttcccatggtgcttgtgggaaacaaatgcgacctc ccggcgcgcacagtcgacacgaggcaagctcaagaactagcgcgctcgtacggcatccct tacatcgagacctctgccaaaacacgacagggagtggaggacgccttctatacgttggtg agggagattcgacagcataagctgaggaagctaaacccgccggacgagagcggccaggac tgtatgagctgtcgctgcgtggtgtcgtga

DBGET integrated database retrieval system