Mugil cephalus (flathead mullet): 125019424 Help Entry 125019424         CDS       T08342                                  Symbol s100a10a Name (RefSeq) protein S100-A10a   KO K17274   protein S100-A10 Organism mcep  Mugil cephalus (flathead mullet) Pathway mcep04382   Cornified envelope formation mcep05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mcep00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     125019424 (s100a10a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125019424 (s100a10a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcep04147]     125019424 (s100a10a) Exosome [BR:mcep04147]  Exosomal proteins   Exosomal proteins of microglial cells    125019424 (s100a10a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EH DUF7078 SUS_N Bcl-2 Motif Other DBs NCBI-GeneID:  125019424 NCBI-ProteinID:  XP_047460148 LinkDB All DBs Position 14:15683666..15685318 Genome browser AA seq 99 aa AA seqDB search MPSELENAMESLIKVFHRYASKDGKGTLNRRELRELMENELSNFLRSQKDPAAVDKIMKD LDANGDGQVDFEEFVSLVVGLSIACEQCYQTHMKKMGKK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgccttcagaactggagaacgcaatggagtcgctcatcaaggtgttccaccgttacgcc tctaaggacggcaagggcacgctcaaccggcgagagctcagagagctgatggagaacgag ctgtctaacttccttaggtctcagaaggaccctgctgccgtggacaagatcatgaaggac ctggatgccaacggtgacggccaggtggactttgaggagtttgtttctctggttgttgga ctttccattgcctgcgagcagtgctatcagacgcacatgaagaagatgggaaagaagtaa

DBGET integrated database retrieval system