Mugil cephalus (flathead mullet): 125021226 Help Entry 125021226         CDS       T08342                                  Symbol ins Name (RefSeq) insulin   KO K04526   insulin Organism mcep  Mugil cephalus (flathead mullet) Pathway mcep04010   MAPK signaling pathway mcep04068   FoxO signaling pathway mcep04081   Hormone signaling mcep04114   Oocyte meiosis mcep04140   Autophagy - animal mcep04150   mTOR signaling pathway mcep04810   Regulation of actin cytoskeleton mcep04910   Insulin signaling pathway mcep04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:mcep00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125021226 (ins)    04068 FoxO signaling pathway     125021226 (ins)    04150 mTOR signaling pathway     125021226 (ins)   09133 Signaling molecules and interaction    04081 Hormone signaling     125021226 (ins)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     125021226 (ins)   09143 Cell growth and death    04114 Oocyte meiosis     125021226 (ins)   09142 Cell motility    04810 Regulation of actin cytoskeleton     125021226 (ins)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     125021226 (ins)    04914 Progesterone-mediated oocyte maturation     125021226 (ins)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcep04052]     125021226 (ins) Cytokines and neuropeptides [BR:mcep04052]  Neuropeptides   Unclassified    125021226 (ins) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  125021226 NCBI-ProteinID:  XP_047463155 LinkDB All DBs Position 15:complement(24052192..24054077) Genome browser AA seq 116 aa AA seqDB search MAALWLQTFSMLLLLVVSWPGSQAVAPPQHLCGSHLVDALYLVCGERGFFYDPKRDVDPL MGFLPSKVGGAAAMGGENEVAEFAFKDQMEMMVKRGIVEQCCHKPCNIFDLQNYCN NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcagctctctggctccagaccttctccatgttgcttctcctggtcgtatcgtggccg ggctcccaggccgtcgcccccccacaacacctgtgtggctcccacctggtcgacgccctc tacctggtctgtggggagagaggcttcttctacgaccccaagagagacgtggaccctctg atgggtttcctgccctcgaaggtgggcggagctgcagccatgggcggagagaacgaagtg gccgagtttgcgttcaaggaccagatggagatgatggtgaagcgaggcatcgtggagcag tgctgccacaagccctgcaacatcttcgacctgcagaactactgcaactga

DBGET integrated database retrieval system