Morococcus cerebrosus: MON37_00220 Help Entry MON37_00220       CDS       T08033                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mcer  Morococcus cerebrosus Pathway mcer01100   Metabolic pathways mcer01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mcer00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MON37_00220 (acpP)    00074 Mycolic acid biosynthesis     MON37_00220 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MON37_00220 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH Ribosomal_L50 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  UNV87425 LinkDB All DBs Position complement(47481..47717) Genome browser AA seq 78 aa AA seqDB search MSNIEQQVKKIVAEQLGVSEAEVKNESSFQDDLGADSLDTVELVMALEEAFGCEIPDEEA EKITTVQLAIDYINAHNG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcaaacatcgaacaacaagttaagaaaattgttgctgaacaactgggcgtaagcgaa gccgaagtcaaaaatgaatcttccttccaagacgacctgggtgcagattctttggacacc gtagaattggttatggctttggaagaagctttcggttgcgaaatccccgatgaagaagcc gaaaaaatcactaccgtacaactggctatcgactacatcaacgcccacaacggctaa

DBGET integrated database retrieval system