KEGG   Macaca fascicularis (crab-eating macaque): 102115085
Entry
102115085         CDS       T02918                                 
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04927  Cortisol synthesis and secretion
mcf04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    102115085
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102115085
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 102115085
NCBI-ProteinID: XP_005548882
Ensembl: ENSMFAG00000000802
UniProt: A0A2K5UAP9 G7P1J5
LinkDB
Position
3:148392923..148411646
AA seq 172 aa
MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVLLLFLILLYM
SWSGSPQMKNSPKHHQTCPWSHSLSLQLCIQKCLPCHREPLGTSRAQARSVEPGSRTDPD
QLLRQESSSTLPLGVFQTHSTLLWELTLSGGPLVRSKPSEPPPGDRTSQLQS
NT seq 519 nt   +upstreamnt  +downstreamnt
atggccaacgggaccaacgcctctgccccatactacagctatgaatactacctggactat
ctggacctcattcccgtagatgagaagaagctgaaagcccacaaacattccatcgtgatc
gccttctgggtgagcctggctgccttcgtgctgctgctcttcctcatcctgctttacatg
tcctggtcgggctccccgcagatgaagaacagccccaagcaccaccaaacatgcccctgg
agtcacagcctcagcctccagctctgcatccagaagtgcctgccgtgccacagggaaccc
ctggggacctcacgggctcaggcgcgttcagtggagccagggagcagaactgaccctgac
cagctgctacgacaggagagctcctccaccttgccccttggggttttccagacccactcc
actctcctctgggaactgaccctcagtgggggtcccctcgtcagaagcaagcccagcgag
cctccccctggagacaggacctctcaattgcagagctga

DBGET integrated database retrieval system