KEGG   Macaca fascicularis (crab-eating macaque): 102131483
Entry
102131483         CDS       T02918                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01521  EGFR tyrosine kinase inhibitor resistance
mcf01522  Endocrine resistance
mcf04010  MAPK signaling pathway
mcf04012  ErbB signaling pathway
mcf04014  Ras signaling pathway
mcf04015  Rap1 signaling pathway
mcf04062  Chemokine signaling pathway
mcf04068  FoxO signaling pathway
mcf04071  Sphingolipid signaling pathway
mcf04072  Phospholipase D signaling pathway
mcf04137  Mitophagy - animal
mcf04140  Autophagy - animal
mcf04150  mTOR signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04210  Apoptosis
mcf04211  Longevity regulating pathway
mcf04213  Longevity regulating pathway - multiple species
mcf04218  Cellular senescence
mcf04360  Axon guidance
mcf04370  VEGF signaling pathway
mcf04371  Apelin signaling pathway
mcf04540  Gap junction
mcf04550  Signaling pathways regulating pluripotency of stem cells
mcf04625  C-type lectin receptor signaling pathway
mcf04650  Natural killer cell mediated cytotoxicity
mcf04660  T cell receptor signaling pathway
mcf04662  B cell receptor signaling pathway
mcf04664  Fc epsilon RI signaling pathway
mcf04714  Thermogenesis
mcf04720  Long-term potentiation
mcf04722  Neurotrophin signaling pathway
mcf04725  Cholinergic synapse
mcf04726  Serotonergic synapse
mcf04730  Long-term depression
mcf04810  Regulation of actin cytoskeleton
mcf04910  Insulin signaling pathway
mcf04912  GnRH signaling pathway
mcf04914  Progesterone-mediated oocyte maturation
mcf04915  Estrogen signaling pathway
mcf04916  Melanogenesis
mcf04917  Prolactin signaling pathway
mcf04919  Thyroid hormone signaling pathway
mcf04921  Oxytocin signaling pathway
mcf04926  Relaxin signaling pathway
mcf04929  GnRH secretion
mcf04933  AGE-RAGE signaling pathway in diabetic complications
mcf04935  Growth hormone synthesis, secretion and action
mcf04960  Aldosterone-regulated sodium reabsorption
mcf05010  Alzheimer disease
mcf05022  Pathways of neurodegeneration - multiple diseases
mcf05034  Alcoholism
mcf05160  Hepatitis C
mcf05161  Hepatitis B
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05200  Pathways in cancer
mcf05203  Viral carcinogenesis
mcf05205  Proteoglycans in cancer
mcf05206  MicroRNAs in cancer
mcf05207  Chemical carcinogenesis - receptor activation
mcf05208  Chemical carcinogenesis - reactive oxygen species
mcf05210  Colorectal cancer
mcf05211  Renal cell carcinoma
mcf05212  Pancreatic cancer
mcf05213  Endometrial cancer
mcf05214  Glioma
mcf05215  Prostate cancer
mcf05216  Thyroid cancer
mcf05218  Melanoma
mcf05219  Bladder cancer
mcf05220  Chronic myeloid leukemia
mcf05221  Acute myeloid leukemia
mcf05223  Non-small cell lung cancer
mcf05224  Breast cancer
mcf05225  Hepatocellular carcinoma
mcf05226  Gastric cancer
mcf05230  Central carbon metabolism in cancer
mcf05231  Choline metabolism in cancer
mcf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcf05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102131483 (KRAS)
   04012 ErbB signaling pathway
    102131483 (KRAS)
   04014 Ras signaling pathway
    102131483 (KRAS)
   04015 Rap1 signaling pathway
    102131483 (KRAS)
   04370 VEGF signaling pathway
    102131483 (KRAS)
   04371 Apelin signaling pathway
    102131483 (KRAS)
   04068 FoxO signaling pathway
    102131483 (KRAS)
   04072 Phospholipase D signaling pathway
    102131483 (KRAS)
   04071 Sphingolipid signaling pathway
    102131483 (KRAS)
   04151 PI3K-Akt signaling pathway
    102131483 (KRAS)
   04150 mTOR signaling pathway
    102131483 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102131483 (KRAS)
   04137 Mitophagy - animal
    102131483 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    102131483 (KRAS)
   04218 Cellular senescence
    102131483 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102131483 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    102131483 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102131483 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102131483 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    102131483 (KRAS)
   04660 T cell receptor signaling pathway
    102131483 (KRAS)
   04662 B cell receptor signaling pathway
    102131483 (KRAS)
   04664 Fc epsilon RI signaling pathway
    102131483 (KRAS)
   04062 Chemokine signaling pathway
    102131483 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102131483 (KRAS)
   04929 GnRH secretion
    102131483 (KRAS)
   04912 GnRH signaling pathway
    102131483 (KRAS)
   04915 Estrogen signaling pathway
    102131483 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    102131483 (KRAS)
   04917 Prolactin signaling pathway
    102131483 (KRAS)
   04921 Oxytocin signaling pathway
    102131483 (KRAS)
   04926 Relaxin signaling pathway
    102131483 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    102131483 (KRAS)
   04919 Thyroid hormone signaling pathway
    102131483 (KRAS)
   04916 Melanogenesis
    102131483 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102131483 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    102131483 (KRAS)
   04726 Serotonergic synapse
    102131483 (KRAS)
   04720 Long-term potentiation
    102131483 (KRAS)
   04730 Long-term depression
    102131483 (KRAS)
   04722 Neurotrophin signaling pathway
    102131483 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    102131483 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    102131483 (KRAS)
   04213 Longevity regulating pathway - multiple species
    102131483 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    102131483 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102131483 (KRAS)
   05206 MicroRNAs in cancer
    102131483 (KRAS)
   05205 Proteoglycans in cancer
    102131483 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    102131483 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    102131483 (KRAS)
   05203 Viral carcinogenesis
    102131483 (KRAS)
   05230 Central carbon metabolism in cancer
    102131483 (KRAS)
   05231 Choline metabolism in cancer
    102131483 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102131483 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102131483 (KRAS)
   05212 Pancreatic cancer
    102131483 (KRAS)
   05225 Hepatocellular carcinoma
    102131483 (KRAS)
   05226 Gastric cancer
    102131483 (KRAS)
   05214 Glioma
    102131483 (KRAS)
   05216 Thyroid cancer
    102131483 (KRAS)
   05221 Acute myeloid leukemia
    102131483 (KRAS)
   05220 Chronic myeloid leukemia
    102131483 (KRAS)
   05218 Melanoma
    102131483 (KRAS)
   05211 Renal cell carcinoma
    102131483 (KRAS)
   05219 Bladder cancer
    102131483 (KRAS)
   05215 Prostate cancer
    102131483 (KRAS)
   05213 Endometrial cancer
    102131483 (KRAS)
   05224 Breast cancer
    102131483 (KRAS)
   05223 Non-small cell lung cancer
    102131483 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102131483 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    102131483 (KRAS)
   05161 Hepatitis B
    102131483 (KRAS)
   05160 Hepatitis C
    102131483 (KRAS)
   05163 Human cytomegalovirus infection
    102131483 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102131483 (KRAS)
   05165 Human papillomavirus infection
    102131483 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102131483 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    102131483 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    102131483 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102131483 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102131483 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102131483 (KRAS)
   01522 Endocrine resistance
    102131483 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcf04131]
    102131483 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mcf04031]
    102131483 (KRAS)
Membrane trafficking [BR:mcf04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    102131483 (KRAS)
GTP-binding proteins [BR:mcf04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    102131483 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin
Other DBs
NCBI-GeneID: 102131483
NCBI-ProteinID: XP_005570435
Ensembl: ENSMFAG00000003804
UniProt: A0A7N9IBD4
LinkDB
Position
11:complement(join(27937785..27937904,27948096..27948255,27949715..27949893,27969822..27969932))
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIIM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcattttgtggacgaatatgatccaacaatagaggattcctac
aggaagcaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagagttaaggactctgaagatgtacctatggtcctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttacggaattcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattataatgtaa

DBGET integrated database retrieval system