Entry |
|
Symbol |
MAPK11
|
Name |
(RefSeq) mitogen-activated protein kinase 11 isoform X1
|
KO |
|
Organism |
mcf Macaca fascicularis (crab-eating macaque)
|
Pathway |
mcf04261 | Adrenergic signaling in cardiomyocytes |
mcf04550 | Signaling pathways regulating pluripotency of stem cells |
mcf04613 | Neutrophil extracellular trap formation |
mcf04620 | Toll-like receptor signaling pathway |
mcf04621 | NOD-like receptor signaling pathway |
mcf04622 | RIG-I-like receptor signaling pathway |
mcf04625 | C-type lectin receptor signaling pathway |
mcf04658 | Th1 and Th2 cell differentiation |
mcf04660 | T cell receptor signaling pathway |
mcf04664 | Fc epsilon RI signaling pathway |
mcf04670 | Leukocyte transendothelial migration |
mcf04723 | Retrograde endocannabinoid signaling |
mcf04750 | Inflammatory mediator regulation of TRP channels |
mcf04914 | Progesterone-mediated oocyte maturation |
mcf04932 | Non-alcoholic fatty liver disease |
mcf04933 | AGE-RAGE signaling pathway in diabetic complications |
mcf04935 | Growth hormone synthesis, secretion and action |
mcf05022 | Pathways of neurodegeneration - multiple diseases |
mcf05163 | Human cytomegalovirus infection |
mcf05167 | Kaposi sarcoma-associated herpesvirus infection |
mcf05170 | Human immunodeficiency virus 1 infection |
mcf05208 | Chemical carcinogenesis - reactive oxygen species |
mcf05235 | PD-L1 expression and PD-1 checkpoint pathway in cancer |
mcf05418 | Fluid shear stress and atherosclerosis |
|
Brite |
KEGG Orthology (KO) [BR:mcf00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
102134421 (MAPK11)
04015 Rap1 signaling pathway
102134421 (MAPK11)
04370 VEGF signaling pathway
102134421 (MAPK11)
04668 TNF signaling pathway
102134421 (MAPK11)
04068 FoxO signaling pathway
102134421 (MAPK11)
04071 Sphingolipid signaling pathway
102134421 (MAPK11)
09140 Cellular Processes
09141 Transport and catabolism
04148 Efferocytosis
102134421 (MAPK11)
09143 Cell growth and death
04114 Oocyte meiosis
102134421 (MAPK11)
04218 Cellular senescence
102134421 (MAPK11)
09144 Cellular community - eukaryotes
04550 Signaling pathways regulating pluripotency of stem cells
102134421 (MAPK11)
09150 Organismal Systems
09151 Immune system
04611 Platelet activation
102134421 (MAPK11)
04613 Neutrophil extracellular trap formation
102134421 (MAPK11)
04620 Toll-like receptor signaling pathway
102134421 (MAPK11)
04621 NOD-like receptor signaling pathway
102134421 (MAPK11)
04622 RIG-I-like receptor signaling pathway
102134421 (MAPK11)
04625 C-type lectin receptor signaling pathway
102134421 (MAPK11)
04660 T cell receptor signaling pathway
102134421 (MAPK11)
04658 Th1 and Th2 cell differentiation
102134421 (MAPK11)
04659 Th17 cell differentiation
102134421 (MAPK11)
04657 IL-17 signaling pathway
102134421 (MAPK11)
04664 Fc epsilon RI signaling pathway
102134421 (MAPK11)
04670 Leukocyte transendothelial migration
102134421 (MAPK11)
09152 Endocrine system
04912 GnRH signaling pathway
102134421 (MAPK11)
04914 Progesterone-mediated oocyte maturation
102134421 (MAPK11)
04917 Prolactin signaling pathway
102134421 (MAPK11)
04926 Relaxin signaling pathway
102134421 (MAPK11)
04935 Growth hormone synthesis, secretion and action
102134421 (MAPK11)
09153 Circulatory system
04261 Adrenergic signaling in cardiomyocytes
102134421 (MAPK11)
09156 Nervous system
04728 Dopaminergic synapse
102134421 (MAPK11)
04723 Retrograde endocannabinoid signaling
102134421 (MAPK11)
04722 Neurotrophin signaling pathway
102134421 (MAPK11)
09157 Sensory system
04750 Inflammatory mediator regulation of TRP channels
102134421 (MAPK11)
09158 Development and regeneration
04380 Osteoclast differentiation
102134421 (MAPK11)
09159 Environmental adaptation
04714 Thermogenesis
102134421 (MAPK11)
09160 Human Diseases
09161 Cancer: overview
05205 Proteoglycans in cancer
102134421 (MAPK11)
05208 Chemical carcinogenesis - reactive oxygen species
102134421 (MAPK11)
05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
102134421 (MAPK11)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
102134421 (MAPK11)
05161 Hepatitis B
102134421 (MAPK11)
05171 Coronavirus disease - COVID-19
102134421 (MAPK11)
05163 Human cytomegalovirus infection
102134421 (MAPK11)
05167 Kaposi sarcoma-associated herpesvirus infection
102134421 (MAPK11)
05169 Epstein-Barr virus infection
102134421 (MAPK11)
09171 Infectious disease: bacterial
05132 Salmonella infection
102134421 (MAPK11)
05135 Yersinia infection
102134421 (MAPK11)
05133 Pertussis
102134421 (MAPK11)
05152 Tuberculosis
102134421 (MAPK11)
09174 Infectious disease: parasitic
05145 Toxoplasmosis
102134421 (MAPK11)
05140 Leishmaniasis
102134421 (MAPK11)
05142 Chagas disease
102134421 (MAPK11)
09164 Neurodegenerative disease
05014 Amyotrophic lateral sclerosis
102134421 (MAPK11)
05020 Prion disease
102134421 (MAPK11)
05022 Pathways of neurodegeneration - multiple diseases
102134421 (MAPK11)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
102134421 (MAPK11)
05418 Fluid shear stress and atherosclerosis
102134421 (MAPK11)
05415 Diabetic cardiomyopathy
102134421 (MAPK11)
09167 Endocrine and metabolic disease
04936 Alcoholic liver disease
102134421 (MAPK11)
04932 Non-alcoholic fatty liver disease
102134421 (MAPK11)
04933 AGE-RAGE signaling pathway in diabetic complications
102134421 (MAPK11)
09176 Drug resistance: antineoplastic
01522 Endocrine resistance
102134421 (MAPK11)
09180 Brite Hierarchies
09181 Protein families: metabolism
01001 Protein kinases [BR:mcf01001]
102134421 (MAPK11)
Enzymes [BR:mcf01000]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.11 Protein-serine/threonine kinases
2.7.11.24 mitogen-activated protein kinase
102134421 (MAPK11)
Protein kinases [BR:mcf01001]
Serine/threonine kinases: CMGC group
MAPK family [OT]
102134421 (MAPK11)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
10:join(1287648..1287763,1290002..1290131,1290325..1290383,1290470..1290581,1290665..1290694,1290777..1290824,1290903..1291017,1291339..1291410,1291645..1291724,1292255..1292333,1292424..1292597,1292895..1292974)
|
AA seq |
364 aa
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFHGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSL
EIEQ |
NT seq |
1095 nt +upstreamnt +downstreamnt
atgtcgggccctcgcgccggcttctaccggcaggagctgaacaagaccgtgtgggaggtg
ccgcagcggctgcaggggctgcgcccggtgggctcgggcgcctacggctccgtctgttcg
gcctacgacgcgcggctgcgccagaaggtggcggtgaagaagctgtcgcgccccttccag
tcgctgatccacgcgcgcaggacgtaccgggagctgcggctgctcaagcacctgaagcac
gagaacgtcatcgggcttctggacgtcttcacgccggccacgtccatcgaggacttcagc
gaagtgtacttggtgaccaccctcatgggtgccgacctgaacaacatcgtcaagtgccag
gcgctgagcgacgagcacgttcagttcctggtttaccaactgctgcgcgggctaaagtac
atccactcggccgggatcatccaccgggacctgaagcccagcaacgtggctgtgaacgag
gactgtgagctcaggatcctggacttcgggctggcgcgccaggcagatgaggagatgacc
ggctacgtggccacgcgctggtaccgggcacctgagataatgctaaactggatgcattac
aaccagacagtggacatctggtccgtgggctgcatcatggctgagctgctccagggcaag
gccctcttcccgggaagcgactacattgaccagctgaagcgcatcatggaagtggtgggc
acacccagccccgaggttctggcaaagatctcctcggaacacgcccggacatacatccag
tccctgccccccatgccccagaaggacctgagcagcatcttccatggagccaaccccctg
gccatagacctccttggaaggatgctggtgctggacagtgaccagagggtcagtgctgcc
gaggcattggcccacgcctacttcagccagtaccatgaccctgaggatgagccagaggcc
gagccgtatgatgagagcgttgaggctaaggagcgcacgctggaggagtggaaggagctc
acctaccaggaagtcctcagcttcaagcccccagagccaccgaagccgcctggcagcctg
gagattgagcagtga |