KEGG   Macaca fascicularis (crab-eating macaque): 102137662
Entry
102137662         CDS       T02918                                 
Symbol
TP53AIP1
Name
(RefSeq) LOW QUALITY PROTEIN: p53-regulated apoptosis-inducing protein 1
  KO
K13773  p53-regulated apoptosis-inducing protein 1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04115  p53 signaling pathway
mcf04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102137662 (TP53AIP1)
   04115 p53 signaling pathway
    102137662 (TP53AIP1)
SSDB
Motif
Pfam: TPIP1
Other DBs
NCBI-GeneID: 102137662
NCBI-ProteinID: XP_045226701
LinkDB
Position
14:5919771..5922960
AA seq 123 aa
MGSSSKASFRSAQASGSGARRQGLGRGDQSLSMMPPNGRAQTHTLDWGSPCTLCLQVHGG
CRGREAPSVSSGSWSSATVWCLTDLGLGLSRPFFPGATVLKDRPSGSAVSLSCDQKKAPL
RLQ
NT seq 372 nt   +upstreamnt  +downstreamnt
atggggtcttcctctaaggcgagcttcagatctgctcaagcttccggcagtggggccagg
aggcagggcctgggcaggggagaccagagcctctcgatgatgcctcccaacggcagggct
cagacacacacactggactggggaagcccctgcactttgtgtctccaagttcacggaggg
tgcaggggaagagaagctccatcagtttcgtctggatcttggtcctcagcaactgtctgg
tgcctgacagaccttggtctaggtctctccaggcctttctttcctggagccacagtgctt
aaagataggccatcggggtcagcggtaagcctgagctgtgatcagaaaaaagcaccattg
aggttgcagtga

DBGET integrated database retrieval system