KEGG   Macaca fascicularis (crab-eating macaque): 102137811
Entry
102137811         CDS       T02918                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8 isoform X1
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102137811 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcf04050]
    102137811 (TNFRSF8)
   04090 CD molecules [BR:mcf04090]
    102137811 (TNFRSF8)
Cytokine receptors [BR:mcf04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102137811 (TNFRSF8)
CD molecules [BR:mcf04090]
 Proteins
  102137811 (TNFRSF8)
SSDB
Other DBs
NCBI-GeneID: 102137811
NCBI-ProteinID: XP_045236442
Ensembl: ENSMFAG00000041782
LinkDB
Position
1:complement(210664944..210744849)
AA seq 614 aa
MNWTERTAIRGRRFLSRLPAGLSGSWADQDRPFEDTCRGNPGHYYDKAVRRCCYRCPTGL
FPTQQCPQRPSDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKMPCAWNSSRVCECQPGM
FCAVSVVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSRI
TSPVSGFFPSGTIPQAKPTPVSPATSNASTMPLRGGTRLAQEAASKLTRAPGSPSSVGRP
SSDPGLSPTQPCPQGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRIC
ECRPGMICATSATNSCARCVPYPICAAETGTKPQDMAEKDTTFEAPPVGTQPDCSPTPEN
GEAPASTSPTLSSLVDSQASKTLPIPTSAPIALSSTGKPVLDAGPVLFWVILVLAVVVGS
STFLLCHRRACRKRIRQKLHLCYPVQTSRPKLELVDSRPRRSSTQFESGTFVTKPSAEEL
GLMSLPPKETCRNVGAACPESLPLWDASPAGGPSSPRDLPEPRVSTEHTNNRIEKIYIMK
ADTVIVGTVKAELPEGQGLAGPAEPELEEELEADHAPHYPEQETEPPLGSCSDVMLSVEE
EGKEDPLPTAASGK
NT seq 1845 nt   +upstreamnt  +downstreamnt
atgaactggaccgagcgcactgccatacgcgggaggcgctttttgtcccgactacctgct
ggcctgtcggggtcctgggcagatcaggatcgacccttcgaggacacctgtcgtggaaac
cccggccactactatgacaaggctgtcaggaggtgctgttaccgctgccccacggggctg
ttcccgacacagcagtgcccacagaggccttctgactgcaggaagcagtgtgaacccgac
tactacctggatgaggccggccgctgtacggcctgcgtgagttgttctcgagacgacctc
gtggagaagatgccgtgtgcgtggaactcctcccgtgtctgcgaatgtcagcctggcatg
ttctgtgccgtgtctgtcgtcaactcctgtgcccgctgcttcttccattctgtctgccca
gcagggatgattgtcaagttcccaggcacggcgcagaagaacacggtctgtgaaccagct
tccccaggcgtcagccctgcctgtgccagcccggagaactgcaaggaaccctccagaatt
accagtcctgtctctggcttcttccccagtggcaccatcccccaggccaagcccaccccg
gtgtccccagcaacctccaatgccagcaccatgcctctaagagggggcacccgcctcgcc
caggaagctgcttctaaactgacaagggctcccggctctccctcctccgtgggaaggcct
agttcggatccaggtctgtccccaacgcagccgtgcccacaggggtctggcgactgcagg
aagcagtgtgagcctgactactacctggacgaggctggccgctgcacggcctgcgtgagc
tgttctcgagacgacctcgtagagaagacgccgtgtgcatggaactcctcccgcatctgc
gaatgtcgacctggcatgatctgtgccacatcagccaccaactcctgtgcccgctgtgtc
ccctacccaatctgtgcagcagagacaggcaccaagccccaggatatggctgagaaggac
accacctttgaggcgccacccgtggggacccagcctgactgcagccccaccccagagaat
ggcgaggcgcctgccagtaccagccccactctgagctccctggtggactcccaggccagt
aagacgctgcccatcccaaccagcgctcccatcgctctctcctccacggggaagcccgtt
ctggatgcagggccagtgctcttctgggtgatcctggtgctggctgtggtggtcggctcc
agcaccttcctcctgtgccaccggagggcctgcaggaagcgaattcgccagaagctccac
ctgtgctacccggtccagacctcccggcccaagctagagcttgtggattccagacccagg
aggagctcaacgcagttcgagagtggtacgtttgtgacaaaacccagtgcggaagagctg
gggttaatgagcctgccaccgaaggagacctgccgcaacgtgggggcagcctgcccggag
agcctgccgctgtgggatgccagcccggccgggggcccctcgtcccccagggaccttcct
gagccccgggtgtccacggagcacaccaataacaggattgagaaaatctacatcatgaag
gccgacactgtgatcgtgggaactgtgaaggctgagctgccagagggccagggcctggcg
gggccggcagagcccgagttggaggaggagctggaggcagaccatgccccccactacccc
gagcaggagacagaaccgcctctgggcagctgcagtgatgtcatgctgtccgtggaagag
gaagggaaagaagaccccttgcccacagctgcctctggaaagtga

DBGET integrated database retrieval system