Entry |
|
Symbol |
PRKACA
|
Name |
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
|
KO |
|
Organism |
mcf Macaca fascicularis (crab-eating macaque)
|
Pathway |
mcf04213 | Longevity regulating pathway - multiple species |
mcf04261 | Adrenergic signaling in cardiomyocytes |
mcf04270 | Vascular smooth muscle contraction |
mcf04723 | Retrograde endocannabinoid signaling |
mcf04750 | Inflammatory mediator regulation of TRP channels |
mcf04914 | Progesterone-mediated oocyte maturation |
mcf04919 | Thyroid hormone signaling pathway |
mcf04923 | Regulation of lipolysis in adipocytes |
mcf04925 | Aldosterone synthesis and secretion |
mcf04927 | Cortisol synthesis and secretion |
mcf04928 | Parathyroid hormone synthesis, secretion and action |
mcf04935 | Growth hormone synthesis, secretion and action |
mcf04961 | Endocrine and other factor-regulated calcium reabsorption |
mcf04962 | Vasopressin-regulated water reabsorption |
mcf05163 | Human cytomegalovirus infection |
mcf05166 | Human T-cell leukemia virus 1 infection |
mcf05207 | Chemical carcinogenesis - receptor activation |
|
Brite |
KEGG Orthology (KO) [BR:mcf00001]
09130 Environmental Information Processing
09132 Signal transduction
04014 Ras signaling pathway
102142443 (PRKACA)
04310 Wnt signaling pathway
102142443 (PRKACA)
04024 cAMP signaling pathway
102142443 (PRKACA)
09133 Signaling molecules and interaction
04082 Neuroactive ligand signaling
102142443 (PRKACA)
04081 Hormone signaling
102142443 (PRKACA)
09140 Cellular Processes
09141 Transport and catabolism
04140 Autophagy - animal
102142443 (PRKACA)
09150 Organismal Systems
09151 Immune system
04611 Platelet activation
102142443 (PRKACA)
04062 Chemokine signaling pathway
102142443 (PRKACA)
09152 Endocrine system
04911 Insulin secretion
102142443 (PRKACA)
04922 Glucagon signaling pathway
102142443 (PRKACA)
04923 Regulation of lipolysis in adipocytes
102142443 (PRKACA)
04913 Ovarian steroidogenesis
102142443 (PRKACA)
04915 Estrogen signaling pathway
102142443 (PRKACA)
04921 Oxytocin signaling pathway
102142443 (PRKACA)
04926 Relaxin signaling pathway
102142443 (PRKACA)
04935 Growth hormone synthesis, secretion and action
102142443 (PRKACA)
04918 Thyroid hormone synthesis
102142443 (PRKACA)
04919 Thyroid hormone signaling pathway
102142443 (PRKACA)
04928 Parathyroid hormone synthesis, secretion and action
102142443 (PRKACA)
04924 Renin secretion
102142443 (PRKACA)
04925 Aldosterone synthesis and secretion
102142443 (PRKACA)
04927 Cortisol synthesis and secretion
102142443 (PRKACA)
09154 Digestive system
04970 Salivary secretion
102142443 (PRKACA)
04971 Gastric acid secretion
102142443 (PRKACA)
04976 Bile secretion
102142443 (PRKACA)
09155 Excretory system
04962 Vasopressin-regulated water reabsorption
102142443 (PRKACA)
04961 Endocrine and other factor-regulated calcium reabsorption
102142443 (PRKACA)
09156 Nervous system
04724 Glutamatergic synapse
102142443 (PRKACA)
04727 GABAergic synapse
102142443 (PRKACA)
04725 Cholinergic synapse
102142443 (PRKACA)
04728 Dopaminergic synapse
102142443 (PRKACA)
04726 Serotonergic synapse
102142443 (PRKACA)
04720 Long-term potentiation
102142443 (PRKACA)
04723 Retrograde endocannabinoid signaling
102142443 (PRKACA)
09157 Sensory system
04740 Olfactory transduction
102142443 (PRKACA)
04742 Taste transduction
102142443 (PRKACA)
04750 Inflammatory mediator regulation of TRP channels
102142443 (PRKACA)
09149 Aging
04211 Longevity regulating pathway
102142443 (PRKACA)
04213 Longevity regulating pathway - multiple species
102142443 (PRKACA)
09159 Environmental adaptation
04713 Circadian entrainment
102142443 (PRKACA)
04714 Thermogenesis
102142443 (PRKACA)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
102142443 (PRKACA)
05205 Proteoglycans in cancer
102142443 (PRKACA)
05207 Chemical carcinogenesis - receptor activation
102142443 (PRKACA)
05203 Viral carcinogenesis
102142443 (PRKACA)
09172 Infectious disease: viral
05166 Human T-cell leukemia virus 1 infection
102142443 (PRKACA)
05163 Human cytomegalovirus infection
102142443 (PRKACA)
05165 Human papillomavirus infection
102142443 (PRKACA)
09174 Infectious disease: parasitic
05146 Amoebiasis
102142443 (PRKACA)
09164 Neurodegenerative disease
05012 Parkinson disease
102142443 (PRKACA)
05020 Prion disease
102142443 (PRKACA)
09165 Substance dependence
05030 Cocaine addiction
102142443 (PRKACA)
05031 Amphetamine addiction
102142443 (PRKACA)
05032 Morphine addiction
102142443 (PRKACA)
05034 Alcoholism
102142443 (PRKACA)
09166 Cardiovascular disease
05414 Dilated cardiomyopathy
102142443 (PRKACA)
09167 Endocrine and metabolic disease
04934 Cushing syndrome
102142443 (PRKACA)
09176 Drug resistance: antineoplastic
01522 Endocrine resistance
102142443 (PRKACA)
09180 Brite Hierarchies
09181 Protein families: metabolism
01001 Protein kinases [BR:mcf01001]
102142443 (PRKACA)
09182 Protein families: genetic information processing
03019 Messenger RNA biogenesis [BR:mcf03019]
102142443 (PRKACA)
03036 Chromosome and associated proteins [BR:mcf03036]
102142443 (PRKACA)
Enzymes [BR:mcf01000]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.11 Protein-serine/threonine kinases
2.7.11.11 cAMP-dependent protein kinase
102142443 (PRKACA)
Protein kinases [BR:mcf01001]
Serine/threonine kinases: AGC group
PKA family
102142443 (PRKACA)
Messenger RNA biogenesis [BR:mcf03019]
Eukaryotic type
mRNA surveillance and transport factors
mRNA cycle factors
Common to processing body (P body) and stress granule
102142443 (PRKACA)
Chromosome and associated proteins [BR:mcf03036]
Eukaryotic type
Centrosome formation proteins
Kinases and associated factors
102142443 (PRKACA)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
19:complement(join(14512384..14512509,14512897..14513061,14516285..14516407,14516501..14516596,14516686..14516812,14520279..14520361,14522367..14522465,14526290..14526418,14526878..14526939,14538524..14538569))
|
AA seq |
351 aa
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF |
NT seq |
1056 nt +upstreamnt +downstreamnt
atgggcaacgccgccgccgccaagaagggcagcgagcaggagagcgtgaaagaattctta
gccaaagccaaagaagattttcttaaaaaatgggaaagtcccgctcagaacacagcccac
ttggatcagtttgaacgaatcaagaccctcggcacgggctccttcgggcgggtgatgctg
gtgaaacacaaggagaccgggaaccactatgccatgaagatcctcgacaaacagaaggtg
gtgaagctgaaacagatcgaacataccctgaatgaaaagcgcatcctgcaagccgtcaac
tttccgttcctcgtcaaactcgagttctccttcaaggacaactcaaacttatacatggtc
atggaatacgtgcccggtggggagatgttctcacacctacggcggattggaaggttcagc
gagccccatgcccgtttctacgcggcccagatcgtcctgaccttcgagtatctgcactcg
ctggatctcatctacagggacctgaagccggagaatctgctcattgaccagcagggatac
attcaggtgacagacttcggtttcgccaagcgcgtgaagggccgcacttggaccttgtgc
ggcacccctgagtatctggcccctgagattatcctgagcaaaggctacaacaaggctgtg
gactggtgggccctgggggttcttatctatgaaatggctgctggctacccgcccttcttc
gcagaccagcccatccagatctatgagaagatcgtctctgggaaggtgcggttcccttcc
cacttcagctctgacttgaaggacctgctgcggaacctcctgcaggtagatcttaccaag
cgctttgggaacctcaagaatggggtcaatgatatcaagaaccacaagtggtttgccacg
actgactggatcgccatctaccagaggaaggtggaagctcccttcataccaaagtttaaa
ggccctggggatacgagtaactttgacgactatgaggaagaagaaatccgggtctccatc
aatgagaagtgtggcaaggagttttctgagttttag |