| Entry |
|
| Symbol |
GNAS
|
| Name |
(RefSeq) guanine nucleotide-binding protein G(s) subunit alpha isoform X15
|
| KO |
| K04632 | guanine nucleotide-binding protein G(s) subunit alpha |
|
| Organism |
mcf Macaca fascicularis (crab-eating macaque)
|
| Pathway |
| mcf04072 | Phospholipase D signaling pathway |
| mcf04261 | Adrenergic signaling in cardiomyocytes |
| mcf04270 | Vascular smooth muscle contraction |
| mcf04750 | Inflammatory mediator regulation of TRP channels |
| mcf04923 | Regulation of lipolysis in adipocytes |
| mcf04925 | Aldosterone synthesis and secretion |
| mcf04927 | Cortisol synthesis and secretion |
| mcf04928 | Parathyroid hormone synthesis, secretion and action |
| mcf04935 | Growth hormone synthesis, secretion and action |
| mcf04961 | Endocrine and other factor-regulated calcium reabsorption |
| mcf04962 | Vasopressin-regulated water reabsorption |
| mcf05163 | Human cytomegalovirus infection |
| mcf05207 | Chemical carcinogenesis - receptor activation |
|
| Brite |
KEGG Orthology (KO) [BR:mcf00001]
09130 Environmental Information Processing
09132 Signal transduction
04015 Rap1 signaling pathway
102145630 (GNAS)
04020 Calcium signaling pathway
102145630 (GNAS)
04072 Phospholipase D signaling pathway
102145630 (GNAS)
04024 cAMP signaling pathway
102145630 (GNAS)
09133 Signaling molecules and interaction
04082 Neuroactive ligand signaling
102145630 (GNAS)
04081 Hormone signaling
102145630 (GNAS)
09140 Cellular Processes
09144 Cellular community - eukaryotes
04540 Gap junction
102145630 (GNAS)
09150 Organismal Systems
09151 Immune system
04611 Platelet activation
102145630 (GNAS)
09152 Endocrine system
04911 Insulin secretion
102145630 (GNAS)
04922 Glucagon signaling pathway
102145630 (GNAS)
04923 Regulation of lipolysis in adipocytes
102145630 (GNAS)
04912 GnRH signaling pathway
102145630 (GNAS)
04913 Ovarian steroidogenesis
102145630 (GNAS)
04915 Estrogen signaling pathway
102145630 (GNAS)
04921 Oxytocin signaling pathway
102145630 (GNAS)
04926 Relaxin signaling pathway
102145630 (GNAS)
04935 Growth hormone synthesis, secretion and action
102145630 (GNAS)
04918 Thyroid hormone synthesis
102145630 (GNAS)
04928 Parathyroid hormone synthesis, secretion and action
102145630 (GNAS)
04916 Melanogenesis
102145630 (GNAS)
04924 Renin secretion
102145630 (GNAS)
04925 Aldosterone synthesis and secretion
102145630 (GNAS)
04927 Cortisol synthesis and secretion
102145630 (GNAS)
09153 Circulatory system
04261 Adrenergic signaling in cardiomyocytes
102145630 (GNAS)
04270 Vascular smooth muscle contraction
102145630 (GNAS)
09154 Digestive system
04970 Salivary secretion
102145630 (GNAS)
04971 Gastric acid secretion
102145630 (GNAS)
04972 Pancreatic secretion
102145630 (GNAS)
04976 Bile secretion
102145630 (GNAS)
09155 Excretory system
04962 Vasopressin-regulated water reabsorption
102145630 (GNAS)
04961 Endocrine and other factor-regulated calcium reabsorption
102145630 (GNAS)
09156 Nervous system
04724 Glutamatergic synapse
102145630 (GNAS)
04728 Dopaminergic synapse
102145630 (GNAS)
04726 Serotonergic synapse
102145630 (GNAS)
04730 Long-term depression
102145630 (GNAS)
09157 Sensory system
04750 Inflammatory mediator regulation of TRP channels
102145630 (GNAS)
09159 Environmental adaptation
04713 Circadian entrainment
102145630 (GNAS)
04714 Thermogenesis
102145630 (GNAS)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
102145630 (GNAS)
05207 Chemical carcinogenesis - receptor activation
102145630 (GNAS)
09172 Infectious disease: viral
05163 Human cytomegalovirus infection
102145630 (GNAS)
05165 Human papillomavirus infection
102145630 (GNAS)
09174 Infectious disease: parasitic
05146 Amoebiasis
102145630 (GNAS)
05142 Chagas disease
102145630 (GNAS)
09164 Neurodegenerative disease
05012 Parkinson disease
102145630 (GNAS)
09165 Substance dependence
05030 Cocaine addiction
102145630 (GNAS)
05031 Amphetamine addiction
102145630 (GNAS)
05032 Morphine addiction
102145630 (GNAS)
05034 Alcoholism
102145630 (GNAS)
09166 Cardiovascular disease
05414 Dilated cardiomyopathy
102145630 (GNAS)
09167 Endocrine and metabolic disease
04934 Cushing syndrome
102145630 (GNAS)
09176 Drug resistance: antineoplastic
01522 Endocrine resistance
102145630 (GNAS)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:mcf04147]
102145630 (GNAS)
04031 GTP-binding proteins [BR:mcf04031]
102145630 (GNAS)
Exosome [BR:mcf04147]
Exosomal proteins
Exosomal proteins of haemopoietic cells (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
102145630 (GNAS)
Exosomal proteins of other body fluids (saliva and urine)
102145630 (GNAS)
Exosomal proteins of colorectal cancer cells
102145630 (GNAS)
Exosomal proteins of bladder cancer cells
102145630 (GNAS)
GTP-binding proteins [BR:mcf04031]
Heterotrimeric G-proteins
Alpha Subunits
Alpha type 2 (Gs)
102145630 (GNAS)
|
| SSDB |
|
| Motif |
|
| Other DBs |
|
| LinkDB |
|
| Position |
10:join(114895380..114895422,114950735..114950807,114958566..114958623,114958709..114958828,114960211..114960308,114963985..114964039,114964173..114964246,114964344..114964402,114964507..114964627,114964774..114964904,114965160..114965227,114965498..114965644)
|
| AA seq |
348 aa
MEDAVQILLVFMDSGAGESGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETI
VAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERS
NEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGG
QRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTIS
VILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFL
RISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL |
| NT seq |
1047 nt +upstreamnt +downstreamnt
atggaggacgccgtccagattctccttgttttcatggattcaggtgctggagaatctggt
aaaagcaccattgtgaagcagatgaggatcctgcatgttaatgggtttaatggagacagt
gagaaggcaaccaaagtgcaggacatcaaaaacaacctgaaagaggcaatcgaaaccatt
gtggccgccatgagcaacctggtgccccccgtggagctggccaaccccgagaaccagttc
agagtggactacattctgagtgtgatgaacgtgcctgactttgacttccctcccgaattc
tacgagcatgccaaggctctgtgggaggacgaaggagtacgtgcctgctatgaacgctcc
aacgagtaccagctgattgactgtgcccagtacttcctggacaagatcgatgtgatcaag
caggctgactatgtgccgagcgaccaggacctgcttcgctgccgcgtcctgacttctgga
atcttcgagaccaagttccaggtggacaaagtcaacttccacatgtttgacgtgggtggc
cagcgcgatgaacgccgcaagtggatccagtgcttcaatgatgtgactgccatcatcttc
gtggtggccagcagcagctacaacatggtcatccgggaggacaaccagaccaaccgcctg
caggaggctctgaacctcttcaagagcatctggaacaacagatggctgcgcaccatctct
gtgattctgttcctcaacaagcaagatctgctcgctgagaaagtccttgctgggaaatcg
aagattgaggactactttccagaatttgctcgctacactactcctgaggatgctactccc
gagcccggagaggacccacgcgtgacccgggccaagtacttcattcgagatgagtttctg
aggatcagcactgccagtggagatgggcgtcactactgctaccctcacttcacctgcgct
gtggacactgagaacatccgccgtgtgttcaacgactgccgtgacatcattcagcgcatg
caccttcgtcagtacgagctgctctaa |