Methylorubrum extorquens CM4: Mchl_0169 Help Entry Mchl_0169         CDS       T00809                                  Name (GenBank) caa(3)-type oxidase, subunit IV   KO K02277   cytochrome c oxidase subunit IV [EC:7.1.1.9] Organism mch  Methylorubrum extorquens CM4 Pathway mch00190   Oxidative phosphorylation mch01100   Metabolic pathways Module mch_M00155   Cytochrome c oxidase, prokaryotes Brite KEGG Orthology (KO) [BR:mch00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Mchl_0169 Enzymes [BR:mch01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.9  cytochrome-c oxidase      Mchl_0169 SSDB OrthologParalogGFIT Motif Pfam:  COX4_pro Motif Other DBs NCBI-ProteinID:  ACK81116 UniProt:  B7L1M2 LinkDB All DBs Position 169468..169770 Genome browser AA seq 100 aa AA seqDB search MRARLQTKAGAIWLRGLVVWLLLLGLLTASLLAAYHLKAPWAPAVNFGLAATQAGLVALL FMRLNRADHLVRLAAACGLFWLAILFALTLTDTLSRLANT NT seq 303 nt NT seq  +upstreamnt  +downstreamnt gtgagggcgcgtcttcagacaaaggccggcgcgatctggctgcgcggcctcgtcgtctgg cttctgcttctggggctcctgacggcaagcctgctcgctgcctaccacctcaaggccccc tgggctccagccgtgaatttcggcctcgctgcgacgcaagccggcctggtcgccctgctg ttcatgcgcctgaaccgtgccgaccaccttgtgcgtctcgccgccgcctgcggcctgttc tggctcgcgatcctgttcgccctgacgctgaccgacacattgagccgcctcgccaacacc tga

DBGET integrated database retrieval system