Methylorubrum extorquens CM4: Mchl_0493 Help Entry Mchl_0493         CDS       T00809                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mch  Methylorubrum extorquens CM4 Pathway mch01100   Metabolic pathways mch01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mch00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Mchl_0493    00074 Mycolic acid biosynthesis     Mchl_0493   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Mchl_0493 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 DUF1493 TerB DUF5783 DNA_Packaging_2 Motif Other DBs NCBI-ProteinID:  ACK81428 UniProt:  B7L0F0 LinkDB All DBs Position 484235..484471 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVVEHLGVEPEKVTEASNFIDDLGADSLDTVELVMAFEEEFNVEIPDDAA ETIQTVGDAIKFLEKNSA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgccgagcgcgtgaagaagatcgtcgtcgagcacctgggcgtcgagcct gagaaggtcaccgaggcctccaacttcatcgacgatctcggcgccgacagcctcgacacc gtcgagctggtgatggcgttcgaggaggagttcaacgtcgagattccggacgacgcggcc gagaccattcagacggtcggtgacgcgatcaagttcctggaaaagaactccgcctga

DBGET integrated database retrieval system