KEGG   Methylorubrum extorquens CM4: Mchl_4641
Entry
Mchl_4641         CDS       T00809                                 
Name
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K15582  oligopeptide transport system permease protein
Organism
mch  Methylorubrum extorquens CM4
Pathway
mch01501  beta-Lactam resistance
mch02010  ABC transporters
mch02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mch00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Mchl_4641
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Mchl_4641
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Mchl_4641
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mch02000]
    Mchl_4641
Transporters [BR:mch02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    Mchl_4641
SSDB
Motif
Pfam: BPD_transp_1 OppC_N
Other DBs
NCBI-ProteinID: ACK85415
UniProt: B7KQ22
LinkDB
Position
4921390..4922481
AA seq 363 aa
MSLALVRRLARDRPALVALASLVLIALACFVGPQLTGHPPERIYPDFVRVAPSLAAHPRP
DAVRPALTRLAFRMRLTLEDVAQDGDRVRMTLTAPKPIDARSLRLLPRSGLFGEARVLER
SADGRRLVVEAPIRRLTFLLGTDALGRDLLSRCLAAGQVSLLIGLTAALAALLIGVAYGA
VSGMAGGTVDALMMRLLDILYALPFVFFVIMLLVFFRAGLWLVLVAVAAVEWLDMARIVR
TQTLSLKDRDFVRAASALGAGTGRILVRHIVPNTLGSIIAAATLLVPRVILLESFLSFLG
LGVQEPDTSWGVLIAEGARALESAPWMLAAPAGFLVVTLVALNRLGDGLGEALDPRLSAA
EAR
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgagcctggcgctcgttcgccgtctcgcccgcgaccgcccggcgctcgtggcccttgcg
agcctcgtgctgattgccctggcctgcttcgtcggcccgcaactcaccgggcacccgccc
gagcggatctatccggatttcgtccgggtcgccccgagccttgccgcccacccgcggccc
gacgcggtgcggccggccctcacgcggcttgccttccggatgcggctgacgctggaagac
gtggcgcaggacggcgaccgggttcgcatgacgctgacggcgccaaaaccgatcgacgcg
cgctccctccgcctgctgccccgctccggcctgttcggcgaggctcgggtgctggagcga
tccgcggatggacgccggctcgtggtcgaggcgccgatccgacggctgaccttcctcctc
ggcaccgatgcgctcgggcgcgacctcctcagccgctgcctcgcggcagggcaggtctcc
ctgctgatcgggctgaccgcggcgctcgccgcgctgctgatcggcgtcgcctacggcgcg
gtctccggcatggccgggggcacggtcgacgcgctgatgatgcgcctcctcgacattctc
tacgccctgcccttcgtcttcttcgtcatcatgctgctggtgttcttccgtgccggcctg
tggctggtgctggtggcggtggccgcggtcgagtggctcgacatggcccgcatcgtccgc
acccagacgctgagtctgaaggaccgcgatttcgtccgcgcggcctcggcgctcggagcg
ggtacgggtaggattctcgtccgccacatcgtgccgaatacgctcggatcgatcatcgcg
gcggcgaccctgctggtgccgcgggtgatccttctggaaagcttcctgtcgttcctcggt
ctcggcgtgcaggagcctgacacctcctggggcgtgctgatcgcggaaggcgcccgcgcg
ctcgaatccgcgccgtggatgctcgccgcacccgcgggtttcctcgtcgtcaccctggtg
gccctgaaccggctcggcgacggcctcggcgaggcgctcgacccgcggctgtccgccgcc
gaggctcgctga

DBGET integrated database retrieval system