Momordica charantia (bitter melon): 111014883 Help Entry 111014883         CDS       T05045                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism mcha  Momordica charantia (bitter melon) Pathway mcha03083   Polycomb repressive complex mcha04120   Ubiquitin mediated proteolysis mcha04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mcha00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111014883    04120 Ubiquitin mediated proteolysis     111014883   09126 Chromosome    03083 Polycomb repressive complex     111014883  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcha04131]     111014883    04121 Ubiquitin system [BR:mcha04121]     111014883    03036 Chromosome and associated proteins [BR:mcha03036]     111014883 Membrane trafficking [BR:mcha04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     111014883 Ubiquitin system [BR:mcha04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      111014883    Cul7 complex      111014883 Chromosome and associated proteins [BR:mcha03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      111014883   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      111014883 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  111014883 NCBI-ProteinID:  XP_022145436 UniProt:  A0A6J1CWB0 LinkDB All DBs Position Unknown AA seq 155 aa AA seqDB search MSSSKKIILKSSDGEPFEVDEAVALESQTIRHMIEDDCADNGIPLPNVSSKILAKVIEYC RKHVDASNSEPRASEEDLKAWDRDFVNVDQATLFDLILAANYLNIKNLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcgtccaagaagatcatcctcaagagctctgatggcgagcctttcgaagtcgac gaggccgtggcgctcgagtcccagaccatccgccacatgatcgaggacgattgcgccgat aacggcatccctctccccaacgtctccagcaagatcttggccaaggtcatcgagtattgc cgcaagcacgtcgacgcttccaactccgagccgcgcgcctctgaagaagacctcaaggcc tgggaccgggacttcgttaatgttgatcaagctactctcttcgatctcattctggctgca aattatctgaacatcaagaacttgttagacctaacatgccagactgttgctgatatgatc aaggggaagaccccagaggagatccggaagacctttaacatcaagaacgacttcacaccg gaggaagaggaggaagttcgcagggagaatcagtgggcttttgaatga

DBGET integrated database retrieval system